(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE352

PENCW_16.PE352       Location/Qualifiers
FT   CDS             join(806736..806768,806830..807354,807404..808984)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948880"
FT                   /orf_name="Pc20g03520"
FT                   /product="Pc20g03520 protein"
FT                   /protein_id="CAP85681.1"
FT                   /db_xref="UniParc:UPI0001831117"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGF0"
FT                   /transl_table=1
FT                   /translation="MVAPSLAVTEFERPSRRVQGTFLMESNNPIYQWLSTVEDQRQSML
FT                   SKRLRSLRANRALAENQEQVKDTALATGIPRIHIPLETSDDLRANGHSASRKRDSRHLK
FT                   ETKASSTHDTIPGSEGHKRSRNCYELRPRYKTREDRYEYKGPSSAVETQSQSRKGRAKK
FT                   PRGRRHTMNDDFRAINVTGNRLTLRSNTNLGIFNKGRSSSVANQRGNTPTGLAKPASVT
FT                   RSQMYVTESDLAFSEMNFLSRRNNLNHPISTVRETLDGQHEREYHPQVQFDDPAHDCNL
FT                   GTSHSIHKLVDVKCKLDDSAMPLFAFEEAPASEISPVFGHSRSASPMPPNKRRKISKQS
FT                   SSIPYTWTETEIDDTEQSDALEQHLLNLLHVGVYPQALCSEIKNTVLTGQYWSLAELWE
FT                   LLKERKASWSNEAGRQIRASPEASTGQLAAVDASLQEVREVIAPGHSDVPSAGSVQNEM
FT                   SKQSADSNVACETACSVNSPPKQSSGLEQQQDRPHEASDKPGPPSLQAARTSNSPDRFI
FT                   DTLNEDQGEPSHQESAEDAVHFPASVPDVEHPHMSDIEFYELGRVDDDDVFYRTLDAAY
FT                   CAIVSPEVAAEVASDLQELLESPELNGNDLPNTPESTNIREPDIPTGQAEVAEPEYLVK
FT                   VSQDIIQNRYDGRPSEPSCQRKLSTSHLNDPCVDQNNELPWVATGYGQTQPRASTGIDA
FT                   GQAKPPGLSGFWRQNRLY"
     MVAPSLAVTE FERPSRRVQG TFLMESNNPI YQWLSTVEDQ RQSMLSKRLR SLRANRALAE        60
     NQEQVKDTAL ATGIPRIHIP LETSDDLRAN GHSASRKRDS RHLKETKASS THDTIPGSEG       120
     HKRSRNCYEL RPRYKTREDR YEYKGPSSAV ETQSQSRKGR AKKPRGRRHT MNDDFRAINV       180
     TGNRLTLRSN TNLGIFNKGR SSSVANQRGN TPTGLAKPAS VTRSQMYVTE SDLAFSEMNF       240
     LSRRNNLNHP ISTVRETLDG QHEREYHPQV QFDDPAHDCN LGTSHSIHKL VDVKCKLDDS       300
     AMPLFAFEEA PASEISPVFG HSRSASPMPP NKRRKISKQS SSIPYTWTET EIDDTEQSDA       360
     LEQHLLNLLH VGVYPQALCS EIKNTVLTGQ YWSLAELWEL LKERKASWSN EAGRQIRASP       420
     EASTGQLAAV DASLQEVREV IAPGHSDVPS AGSVQNEMSK QSADSNVACE TACSVNSPPK       480
     QSSGLEQQQD RPHEASDKPG PPSLQAARTS NSPDRFIDTL NEDQGEPSHQ ESAEDAVHFP       540
     ASVPDVEHPH MSDIEFYELG RVDDDDVFYR TLDAAYCAIV SPEVAAEVAS DLQELLESPE       600
     LNGNDLPNTP ESTNIREPDI PTGQAEVAEP EYLVKVSQDI IQNRYDGRPS EPSCQRKLST       660
     SHLNDPCVDQ NNELPWVATG YGQTQPRAST GIDAGQAKPP GLSGFWRQNR LY               712
//

If you have problems or comments...

PBIL Back to PBIL home page