(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE353

PENCW_16.PE353       Location/Qualifiers
FT   CDS             join(complement(809925..810198),complement(809751..809803))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195681" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824637"
FT                   /orf_name="Pc20g03530"
FT                   /product="Pc20g03530 protein"
FT                   /protein_id="CAP85682.1"
FT                   /db_xref="UniParc:UPI0001831118"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGF1"
FT                   /transl_table=1
FT                   /translation="MSFPSPDSSNPSFSMSAYMVPSRQNSYSESDDELASLPSESTNDS
FT                   DLETLSEYSSDAEAEWQESIEQLELLLTMVLVPFIGKYLGRRCAYWNPAAFKAAGVVEA
FT                   AASL"
     MSFPSPDSSN PSFSMSAYMV PSRQNSYSES DDELASLPSE STNDSDLETL SEYSSDAEAE        60
     WQESIEQLEL LLTMVLVPFI GKYLGRRCAY WNPAAFKAAG VVEAAASL                    108
//

If you have problems or comments...

PBIL Back to PBIL home page