(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE354

PENCW_16.PE354       Location/Qualifiers
FT   CDS             join(810839..811464,811529..811826)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000107197" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824638"
FT                   /orf_name="Pc20g03540"
FT                   /product="Pc20g03540 protein"
FT                   /function="translation initiation factor activity "
FT                   /protein_id="CAP85683.1"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="InterPro:IPR002735"
FT                   /db_xref="InterPro:IPR016189"
FT                   /db_xref="InterPro:IPR016190"
FT                   /db_xref="UniParc:UPI0001831119"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGF2"
FT                   /transl_table=1
FT                   /translation="MDTNGQVTDAPPAEKPTGGMQYLSDPSLNPPVAFATAPLTMSEYT
FT                   EKEVDEVTEMFKGLSKKKKPSKKSKTADAGDDEEAPAADGEFDPSALKKKKKSSSKSKK
FT                   ADATDFDAKLAEAGIAEEAGEEKPEEIPEGDLEAGTGIWAHDATQTIPYSLLVSRFFSL
FT                   IESHHPDLLATGAKSYKIPPPQCLREGNRRTIFANIADICKRMKRSEEHCTQFLFAELG
FT                   TSGSVDGSRRLVIKGRFQQKGIESVLRRYIVEYVTCKTCRSPDTELNKGENRLYFVTCN
FT                   SCGSRRSVAAIKTGFRSQIGRRKRVG"
     MDTNGQVTDA PPAEKPTGGM QYLSDPSLNP PVAFATAPLT MSEYTEKEVD EVTEMFKGLS        60
     KKKKPSKKSK TADAGDDEEA PAADGEFDPS ALKKKKKSSS KSKKADATDF DAKLAEAGIA       120
     EEAGEEKPEE IPEGDLEAGT GIWAHDATQT IPYSLLVSRF FSLIESHHPD LLATGAKSYK       180
     IPPPQCLREG NRRTIFANIA DICKRMKRSE EHCTQFLFAE LGTSGSVDGS RRLVIKGRFQ       240
     QKGIESVLRR YIVEYVTCKT CRSPDTELNK GENRLYFVTC NSCGSRRSVA AIKTGFRSQI       300
     GRRKRVG                                                                 307
//

If you have problems or comments...

PBIL Back to PBIL home page