(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE355

PENCW_16.PE355       Location/Qualifiers
FT   CDS             join(complement(813652..813678),complement(813078..813597),
FT                   complement(812642..812991),complement(812361..812579))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195692" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824639"
FT                   /orf_name="Pc20g03550"
FT                   /product="Pc20g03550 protein"
FT                   /protein_id="CAP85684.1"
FT                   /db_xref="InterPro:IPR002838"
FT                   /db_xref="InterPro:IPR016031"
FT                   /db_xref="UniParc:UPI000183111A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGF3"
FT                   /transl_table=1
FT                   /translation="MNIPLRLCLLRRLRHVVTIPSIGSKAILMRRVAFSPPHQPYFAPP
FT                   PRQTPPSNGDHPVPQSSISPPAMSPPTNKQGYAMAEYPAPTTASPPPPDQIAEQNQAAF
FT                   LQNQALSRLSISSRPPQTVTMEKMPGGAPAYGQFVGTHSTYQDDVGVFNGGSYRISHRD
FT                   TNSLLTLQLAVGCPLTVRPGAMIAMSPTITLRGHVSFSFKKLIIGGSMTTSQYTGPGEV
FT                   LLAPPMLGDIVVLPIDTGEAWNAGRDSFLAHTSGVHHLYQSQGLSKGFFSGEGFFVYEF
FT                   TGHGLLWLQSFGAIVKKDLREGESYFVDNGHLVAWKCAYEIERPASGGLLSSFSSGEGL
FT                   ACRFKGPGTVYLQTRNLKAFATQMKVTSSYL"
     MNIPLRLCLL RRLRHVVTIP SIGSKAILMR RVAFSPPHQP YFAPPPRQTP PSNGDHPVPQ        60
     SSISPPAMSP PTNKQGYAMA EYPAPTTASP PPPDQIAEQN QAAFLQNQAL SRLSISSRPP       120
     QTVTMEKMPG GAPAYGQFVG THSTYQDDVG VFNGGSYRIS HRDTNSLLTL QLAVGCPLTV       180
     RPGAMIAMSP TITLRGHVSF SFKKLIIGGS MTTSQYTGPG EVLLAPPMLG DIVVLPIDTG       240
     EAWNAGRDSF LAHTSGVHHL YQSQGLSKGF FSGEGFFVYE FTGHGLLWLQ SFGAIVKKDL       300
     REGESYFVDN GHLVAWKCAY EIERPASGGL LSSFSSGEGL ACRFKGPGTV YLQTRNLKAF       360
     ATQMKVTSSY L                                                            371
//

If you have problems or comments...

PBIL Back to PBIL home page