(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE356

PENCW_16.PE356       Location/Qualifiers
FT   CDS             join(complement(818097..818189),complement(817454..818032),
FT                   complement(814603..817419))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000234561" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948881"
FT                   /orf_name="Pc20g03560"
FT                   /product="Pc20g03560 protein"
FT                   /protein_id="CAP85685.1"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000183111B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGF4"
FT                   /transl_table=1
FT                   /translation="MLSILFFISLFPFVKADDDWDDFTNNLATDLAPLITLFGERLTKQ
FT                   FLSESISILDNVIFALSPLGVLTAVVSVIRICGSSSLRAFVGRAQEGPAEAESELLPCV
FT                   SESTAELFNDGGITRVFGRPKIVEIVAWQDVNHKTGEKETKIGTLKDALEEKAWSCNNK
FT                   VLPTELPELDIPNLSLNKGIKRRDQFWFHCAAILGGVLQTGRCFSSFEPEITLTIHLRY
FT                   HYHFKKDDKAVASYAFPLYLIGTTLLFLGMFFCAFIMERSSKEFYLKAEKPSKIYWLQP
FT                   GNQDVGDQVFNAFLAVNEGPESSMTKKLRYTKSIRDRRFDRKYLEIYSTLTSTVLGFIF
FT                   QFIGLRGLHASVILAQLGSTFIMSIIRTCLRTERMAPDENKMKDDRDLMGHKQQELDAF
FT                   AFYLENVEYFNMVLLPDRPATIPSPRFVPHVDAPLARQLIRTRTQLANLTSNPNQSSSA
FT                   TWDDMPIRRMAHNLAQTIESTMDLISGWGVDLGKTFEFRLGFECRGASPGSVTQSPGTY
FT                   SIGLMRCGDALRWKMEASEIEAILGLWTWSLYKSGDDCKSSRLFRLVGLSEEEASKKET
FT                   YLYFHKWIFRQTEARLVPSDLIDDSRRLFGFEPKEGLPLGNLLVIKTENEVETMAAQDI
FT                   FIQFLKEVCLNVKELGGEVDVVSGIQNSLLGSCTRIDELVSCFEAHSLGSREDALLCIV
FT                   PVLRNRNLLPDLAADCAKVRARREQLISQGKWKNAFDLLRWLCERSEGPQFQRSVYELG
FT                   YLCLRALLNNSETVRKEGFAQVCKLLNSDIREEFLQTQKILLPSDWSMSQDRIEWWRSF
FT                   SSELGWTAWSISEEVPGMSFMEPALKSLNVPQSLPGVIGTGQDLQATEDAMRSMQDWLT
FT                   LRDLVNAGFRRLREEEDNRLCFEWAVENNYHCLLYFLLLKWVELNDRIPFLITIAYTLA
FT                   ATKHSHLATQTLLRQGTNIDATDVQGHTALFNQAAVGHVEGIVMLLDNGADPNGSNEAP
FT                   NARPLIAAVYGGHLMAVALLLQYGADANMTDQHGMSALLWAMASDYIDIVELLLSSGAE
FT                   TESVMSDGSTALIWASTDKSLPILELLIKHGADINAQDTDGKTALMRAVSRERSLPVLR
FT                   VLLDKGADVHMEDDKGRTALDMARKANFHEAVAILKSSDRNSLASWLPDLTSRSP"
     MLSILFFISL FPFVKADDDW DDFTNNLATD LAPLITLFGE RLTKQFLSES ISILDNVIFA        60
     LSPLGVLTAV VSVIRICGSS SLRAFVGRAQ EGPAEAESEL LPCVSESTAE LFNDGGITRV       120
     FGRPKIVEIV AWQDVNHKTG EKETKIGTLK DALEEKAWSC NNKVLPTELP ELDIPNLSLN       180
     KGIKRRDQFW FHCAAILGGV LQTGRCFSSF EPEITLTIHL RYHYHFKKDD KAVASYAFPL       240
     YLIGTTLLFL GMFFCAFIME RSSKEFYLKA EKPSKIYWLQ PGNQDVGDQV FNAFLAVNEG       300
     PESSMTKKLR YTKSIRDRRF DRKYLEIYST LTSTVLGFIF QFIGLRGLHA SVILAQLGST       360
     FIMSIIRTCL RTERMAPDEN KMKDDRDLMG HKQQELDAFA FYLENVEYFN MVLLPDRPAT       420
     IPSPRFVPHV DAPLARQLIR TRTQLANLTS NPNQSSSATW DDMPIRRMAH NLAQTIESTM       480
     DLISGWGVDL GKTFEFRLGF ECRGASPGSV TQSPGTYSIG LMRCGDALRW KMEASEIEAI       540
     LGLWTWSLYK SGDDCKSSRL FRLVGLSEEE ASKKETYLYF HKWIFRQTEA RLVPSDLIDD       600
     SRRLFGFEPK EGLPLGNLLV IKTENEVETM AAQDIFIQFL KEVCLNVKEL GGEVDVVSGI       660
     QNSLLGSCTR IDELVSCFEA HSLGSREDAL LCIVPVLRNR NLLPDLAADC AKVRARREQL       720
     ISQGKWKNAF DLLRWLCERS EGPQFQRSVY ELGYLCLRAL LNNSETVRKE GFAQVCKLLN       780
     SDIREEFLQT QKILLPSDWS MSQDRIEWWR SFSSELGWTA WSISEEVPGM SFMEPALKSL       840
     NVPQSLPGVI GTGQDLQATE DAMRSMQDWL TLRDLVNAGF RRLREEEDNR LCFEWAVENN       900
     YHCLLYFLLL KWVELNDRIP FLITIAYTLA ATKHSHLATQ TLLRQGTNID ATDVQGHTAL       960
     FNQAAVGHVE GIVMLLDNGA DPNGSNEAPN ARPLIAAVYG GHLMAVALLL QYGADANMTD      1020
     QHGMSALLWA MASDYIDIVE LLLSSGAETE SVMSDGSTAL IWASTDKSLP ILELLIKHGA      1080
     DINAQDTDGK TALMRAVSRE RSLPVLRVLL DKGADVHMED DKGRTALDMA RKANFHEAVA      1140
     ILKSSDRNSL ASWLPDLTSR SP                                               1162
//

If you have problems or comments...

PBIL Back to PBIL home page