(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE357

PENCW_16.PE357       Location/Qualifiers
FT   CDS             join(819423..819485,819548..819980,820032..820256,
FT                   820310..820365)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195703" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977859"
FT                   /orf_name="Pc20g03570"
FT                   /product="Pc20g03570 protein"
FT                   /protein_id="CAP85686.1"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="UniParc:UPI000183111C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGF5"
FT                   /transl_table=1
FT                   /translation="MAASSEFASAMTTRSLRMVRTELEFLADASVITPQQLSSILSQLP
FT                   TDSETSRAVYTSPSPPRQQAQPAPAQHVPVQAQPPPAPYTPSYSPPVSQMNNVSINEKA
FT                   FMHNQHVPVQAQPPQAPPAYPQVPPVLGLASAMYAYTPTDAGDLALQPQDRIQIIEHMN
FT                   DDWWRGRNERTGQEGIFPRSYVNVVNEKAGISSPPPTNYGNMPLAVSQSGQPEDPNDPK
FT                   KNKFEEGGKKFGKKLGNAAIFGAGATVGSNIVNSIF"
     MAASSEFASA MTTRSLRMVR TELEFLADAS VITPQQLSSI LSQLPTDSET SRAVYTSPSP        60
     PRQQAQPAPA QHVPVQAQPP PAPYTPSYSP PVSQMNNVSI NEKAFMHNQH VPVQAQPPQA       120
     PPAYPQVPPV LGLASAMYAY TPTDAGDLAL QPQDRIQIIE HMNDDWWRGR NERTGQEGIF       180
     PRSYVNVVNE KAGISSPPPT NYGNMPLAVS QSGQPEDPND PKKNKFEEGG KKFGKKLGNA       240
     AIFGAGATVG SNIVNSIF                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page