(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE358

PENCW_16.PE358       Location/Qualifiers
FT   CDS             join(822108..822263,822325..822633)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195726" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977860"
FT                   /orf_name="Pc20g03580"
FT                   /product="Pc20g03580 protein"
FT                   /function="sequence-specific DNA binding"
FT                   /protein_id="CAP85687.1"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR013729"
FT                   /db_xref="UniParc:UPI000183111D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGF6"
FT                   /transl_table=1
FT                   /translation="MSDWESTTKIGSKFRGAGAQPRETVVKGKSALNAAQRSGSVYTEK
FT                   KYTTGNLSAKAGAPEGQHLTKVDRSDDIVKPKTVGHAVADAIKRRRTEEGYKMTQKELA
FT                   TKCNTTITIVQDFERGTATPDQKVLGSMERVLNIKLRGSDIGSEKFPKKK"
     MSDWESTTKI GSKFRGAGAQ PRETVVKGKS ALNAAQRSGS VYTEKKYTTG NLSAKAGAPE        60
     GQHLTKVDRS DDIVKPKTVG HAVADAIKRR RTEEGYKMTQ KELATKCNTT ITIVQDFERG       120
     TATPDQKVLG SMERVLNIKL RGSDIGSEKF PKKK                                   154
//

If you have problems or comments...

PBIL Back to PBIL home page