(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE359

PENCW_16.PE359       Location/Qualifiers
FT   CDS             join(complement(824634..824660),complement(824061..824567),
FT                   complement(823890..824006),complement(823660..823836),
FT                   complement(823416..823598))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000231322" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948882"
FT                   /orf_name="Pc20g03590"
FT                   /product="Pc20g03590 protein"
FT                   /protein_id="CAP85688.1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI000183111E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGF7"
FT                   /transl_table=1
FT                   /translation="MRPILLSGHERSLTQIKFNSDGDLLFSVSKDKIVCAWWSANGERL
FT                   GTYNGHQGAVWTVDVSPNTILLATGSADNTVRLWNVKTGECVKVWEFSTAVKRVSFSPD
FT                   GNRLLAVTEKRMGFNGTIAVLDISYGENLSAQAAEPTLTIVCEESKATVAGWSFLSKYI
FT                   IAGHEDGSVSQYDPKSGDQLENVQIHEFDSQITDIQFAPDRLSFITASKDKSAKLLSSR
FT                   NLAILKTYISDTPLNTASVTPKKEFVILGGGQAAMDVTTTSARQGKFEARFYHKVFEDE
FT                   CGRVRGHFGPLNTIDVHPAGTAYASGGEDGYVRVHHFDKSYFDFMYEVEREQARK"
     MRPILLSGHE RSLTQIKFNS DGDLLFSVSK DKIVCAWWSA NGERLGTYNG HQGAVWTVDV        60
     SPNTILLATG SADNTVRLWN VKTGECVKVW EFSTAVKRVS FSPDGNRLLA VTEKRMGFNG       120
     TIAVLDISYG ENLSAQAAEP TLTIVCEESK ATVAGWSFLS KYIIAGHEDG SVSQYDPKSG       180
     DQLENVQIHE FDSQITDIQF APDRLSFITA SKDKSAKLLS SRNLAILKTY ISDTPLNTAS       240
     VTPKKEFVIL GGGQAAMDVT TTSARQGKFE ARFYHKVFED ECGRVRGHFG PLNTIDVHPA       300
     GTAYASGGED GYVRVHHFDK SYFDFMYEVE REQARK                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page