(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE36

PENCW_16.PE36        Location/Qualifiers
FT   CDS             join(complement(85982..86175),complement(85920..85926),
FT                   complement(85704..85864),complement(85259..85647),
FT                   complement(84711..85199),complement(84203..84642))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000261848" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946684"
FT                   /gene_name="Dip5"
FT                   /orf_name="Pc20g00360"
FT                   /product="Dicarboxylic amino acid permease Dip5-Penicillium
FT                   chrysogenum"
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP85365.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI00018319DC"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFD3"
FT                   /transl_table=1
FT                   /translation="MGHPDEINALEAQPGYVDNLGDFKESEQDEPVQLHRELKARHISM
FT                   IAIGGAIGTGLVVGTGSALTAGPGSLFIAYCFMGFVVWTVMCGLGEMAAWLPLSSGFTG
FT                   YAGRFCDPALGFTLGWCYYLKYIILPPTQLTAAALVITYWPRTSAENVNPGVWIAIFMV
FT                   AIIVINYFGVKIFGELEFWLSSFKVIVILGLILCSLIFALGGGPDHDRRGFRYWNKPGA
FT                   FATKYTDGALGKFLAFWSTMVQATFAFLGTELIGVTVGEAQNPRKTIPKAIKLTFWRII
FT                   VFYILSVLFLGMLVPYDSKELAFATEAESSAAASPFVVAMGQVAALPHIINGCILVFVF
FT                   SAANSDLYIATRTLYGLAREKKAPKIFARTNRAGVPIYSLALSASFCLLAFMSVSSTSK
FT                   EVFGYFTDMVSIFGLLTWVSLLITHIFFIRARRAQGVDQATLAYKAPLGIIGSCIALFF
FT                   CVLVLFTRSFGVFIHDPETYGNFDYKTFITSYIGIPLYVAAFAGWKIWNKTEIIKPHNA
FT                   DIWTGKAEIDREEAEYVAMVAIQDQNLSGWNKVYRKSLAWLF"
     MGHPDEINAL EAQPGYVDNL GDFKESEQDE PVQLHRELKA RHISMIAIGG AIGTGLVVGT        60
     GSALTAGPGS LFIAYCFMGF VVWTVMCGLG EMAAWLPLSS GFTGYAGRFC DPALGFTLGW       120
     CYYLKYIILP PTQLTAAALV ITYWPRTSAE NVNPGVWIAI FMVAIIVINY FGVKIFGELE       180
     FWLSSFKVIV ILGLILCSLI FALGGGPDHD RRGFRYWNKP GAFATKYTDG ALGKFLAFWS       240
     TMVQATFAFL GTELIGVTVG EAQNPRKTIP KAIKLTFWRI IVFYILSVLF LGMLVPYDSK       300
     ELAFATEAES SAAASPFVVA MGQVAALPHI INGCILVFVF SAANSDLYIA TRTLYGLARE       360
     KKAPKIFART NRAGVPIYSL ALSASFCLLA FMSVSSTSKE VFGYFTDMVS IFGLLTWVSL       420
     LITHIFFIRA RRAQGVDQAT LAYKAPLGII GSCIALFFCV LVLFTRSFGV FIHDPETYGN       480
     FDYKTFITSY IGIPLYVAAF AGWKIWNKTE IIKPHNADIW TGKAEIDREE AEYVAMVAIQ       540
     DQNLSGWNKV YRKSLAWLF                                                    559
//

If you have problems or comments...

PBIL Back to PBIL home page