(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE360

PENCW_16.PE360       Location/Qualifiers
FT   CDS             join(825426..825549,825619..825639,825694..825731,
FT                   825784..828311,828366..828474)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000040280" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948883"
FT                   /orf_name="Pc20g03600"
FT                   /product="Pc20g03600 protein"
FT                   /function="ATP binding"
FT                   /function="formate-tetrahydrofolate ligase activity "
FT                   /function="methenyltetrahydrofolate cyclohydrolase activity"
FT                   /function="methylenetetrahydrofolate dehydrogenase (NADP+)
FT                   activity"
FT                   /biological_process="folic acid-containing compound
FT                   biosynthetic process"
FT                   /biological_process="one-carbon metabolic process "
FT                   /protein_id="CAP85689.1"
FT                   /db_xref="GO:0004329"
FT                   /db_xref="GO:0004477"
FT                   /db_xref="GO:0004488"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006730"
FT                   /db_xref="GO:0009396"
FT                   /db_xref="InterPro:IPR000559"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020628"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR020867"
FT                   /db_xref="UniParc:UPI000183111F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGF8"
FT                   /transl_table=1
FT                   /translation="MAAAKIDGTAIAKSIRQGLKSEIEQIQVNNPRFKPNLVIFQVGSR
FT                   SDSSTYVRMKLKAAQEANIICTLINVPESSTELELIQEITKANYDPAIHGILVQLPLPS
FT                   HMSEHAITSTVADEKDVDGFGAINIGELAKRGGRPLFTPCTPLAVMELLKASGVDPAGK
FT                   EAVVLGRSDIVGSPVSYLLKNADATVTVCHSKTPDIARVVKTADIVVAAIGQTELVKGD
FT                   WLKPGAVVIDVGINYKPDATKKSGERLVGDVDFESASQVASQITPVPGGVGPMTVAMLL
FT                   KNVVHSAKGYFEKQKDRHVTPLPLRLQTPVPSDIAISRAQYPKPITQIATEVGIAPHEL
FT                   EPYGHTKAKINLSVLDRLAHRRNGRYILVAGITPTPLGEGKSTTTLGLTQALGAHLNRI
FT                   SFANVRQPSQGPTFGIKGGAAGGGYSQVIPMDEFNLHLTGDIHAITAANNLLAAAIETR
FT                   MFHESTQKDAALYKRLVPASKGKREFKPIMFRRLKKLGIEKTNPDDLTEEEITRFARLD
FT                   IDPETITWRRVLDVNDRHLRGITVGQADTEKGLSRETGFDISVASECMAILALSNDLED
FT                   MRERLGRMVVATSRNGDPVTCDDIGAGGALAALMKDAIKPNMMQSLEGTPVMVHAGPFA
FT                   NISIGASSAIADKLALKLAGTEPDEDHEAKTGFVVTEAGFDFTMGGERFFNIKCRSSGL
FT                   VPDTVVIVATVRALKVHGGGPEIKPGAPLQEVYRTENVDVLRQGCVNLRKHIANAKQYG
FT                   VPVVVAINKFETDTDAEIAVIREEAIAAGAEDAVPANHWAEGGAGAVDLAKAVMTASSK
FT                   EKHFQLLYGLDGTIQERIERIGQAMYGAEKVEFSELAQKKVDTYTKQGFSNLPICIAKT
FT                   QYSLSHDPALKGAPTGFTVPIRDVRLAVGAGYLYALAADIQTIPGLPTAPGYLNVDIDT
FT                   ETGDIDGLF"
     MAAAKIDGTA IAKSIRQGLK SEIEQIQVNN PRFKPNLVIF QVGSRSDSST YVRMKLKAAQ        60
     EANIICTLIN VPESSTELEL IQEITKANYD PAIHGILVQL PLPSHMSEHA ITSTVADEKD       120
     VDGFGAINIG ELAKRGGRPL FTPCTPLAVM ELLKASGVDP AGKEAVVLGR SDIVGSPVSY       180
     LLKNADATVT VCHSKTPDIA RVVKTADIVV AAIGQTELVK GDWLKPGAVV IDVGINYKPD       240
     ATKKSGERLV GDVDFESASQ VASQITPVPG GVGPMTVAML LKNVVHSAKG YFEKQKDRHV       300
     TPLPLRLQTP VPSDIAISRA QYPKPITQIA TEVGIAPHEL EPYGHTKAKI NLSVLDRLAH       360
     RRNGRYILVA GITPTPLGEG KSTTTLGLTQ ALGAHLNRIS FANVRQPSQG PTFGIKGGAA       420
     GGGYSQVIPM DEFNLHLTGD IHAITAANNL LAAAIETRMF HESTQKDAAL YKRLVPASKG       480
     KREFKPIMFR RLKKLGIEKT NPDDLTEEEI TRFARLDIDP ETITWRRVLD VNDRHLRGIT       540
     VGQADTEKGL SRETGFDISV ASECMAILAL SNDLEDMRER LGRMVVATSR NGDPVTCDDI       600
     GAGGALAALM KDAIKPNMMQ SLEGTPVMVH AGPFANISIG ASSAIADKLA LKLAGTEPDE       660
     DHEAKTGFVV TEAGFDFTMG GERFFNIKCR SSGLVPDTVV IVATVRALKV HGGGPEIKPG       720
     APLQEVYRTE NVDVLRQGCV NLRKHIANAK QYGVPVVVAI NKFETDTDAE IAVIREEAIA       780
     AGAEDAVPAN HWAEGGAGAV DLAKAVMTAS SKEKHFQLLY GLDGTIQERI ERIGQAMYGA       840
     EKVEFSELAQ KKVDTYTKQG FSNLPICIAK TQYSLSHDPA LKGAPTGFTV PIRDVRLAVG       900
     AGYLYALAAD IQTIPGLPTA PGYLNVDIDT ETGDIDGLF                              939
//

If you have problems or comments...

PBIL Back to PBIL home page