(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE362

PENCW_16.PE362       Location/Qualifiers
FT   CDS             join(832471..832518,832606..832642,832705..832772,
FT                   832840..833222,833282..833349,833415..833932)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824640"
FT                   /orf_name="Pc20g03620"
FT                   /product="Pc20g03620 protein"
FT                   /protein_id="CAP85691.1"
FT                   /db_xref="UniParc:UPI0001831121"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGG0"
FT                   /transl_table=1
FT                   /translation="MVKAPGLDDLIISCALICDLAFYACIILERKYGIGIHSSKLSEYD
FT                   LQNQLFWLWLSVPFYNMTMIFAKLSALTLFARLFRPRPFLLATYIIMGALVIIGLWTTL
FT                   SGFFFCVPVNAFWDPSEDVRLANCLPAAPVWFTNAALQTSTDLVILVMPMPLLWKLQLP
FT                   KRQKWGILVVFSLGIFIIGTSSARLYPLSIMVGGGDFLEENAQAALWSSLEANVSIICI
FT                   SLPPLHPLLSRIFSFCFLPRPIQSRASKRRSSRTQMTEPLNRDGGIWCNELFTPGPASY
FT                   CTSISKVNTNEEDHENEEGIRVKRELRMQSDTLPTPDIEPHSANGVHLDMGEGAVAARS
FT                   HTAPENPRSNSSVERDFVDFEFPDYREKMNAPI"
     MVKAPGLDDL IISCALICDL AFYACIILER KYGIGIHSSK LSEYDLQNQL FWLWLSVPFY        60
     NMTMIFAKLS ALTLFARLFR PRPFLLATYI IMGALVIIGL WTTLSGFFFC VPVNAFWDPS       120
     EDVRLANCLP AAPVWFTNAA LQTSTDLVIL VMPMPLLWKL QLPKRQKWGI LVVFSLGIFI       180
     IGTSSARLYP LSIMVGGGDF LEENAQAALW SSLEANVSII CISLPPLHPL LSRIFSFCFL       240
     PRPIQSRASK RRSSRTQMTE PLNRDGGIWC NELFTPGPAS YCTSISKVNT NEEDHENEEG       300
     IRVKRELRMQ SDTLPTPDIE PHSANGVHLD MGEGAVAARS HTAPENPRSN SSVERDFVDF       360
     EFPDYREKMN API                                                          373
//

If you have problems or comments...

PBIL Back to PBIL home page