(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE364

PENCW_16.PE364       Location/Qualifiers
FT   CDS             complement(836348..837574)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948885"
FT                   /orf_name="Pc20g03640"
FT                   /product="Pc20g03640 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP85693.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI0001831123"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGS7"
FT                   /transl_table=1
FT                   /translation="MKGKKPRGIRHDRDCGRCKVRGIKCDLNRPRCQACLQGGEACNYP
FT                   QRVVWVDDKKPKRPKGTSPQIHNAETPNVEAYKSASINLYGFIDLLDAFCQQIQSSSRD
FT                   IPEEGIQLISRTLSFARSRVQDANNKESLQSHLVALTNLSQVIQSAHPIALFGIATFAM
FT                   FEVCCGSFGNWHCHLQGARSLLDLHCQHKADLDDLCGEISGLADVLAYLVWFDVTGALV
FT                   RESPLIFEDWHRETLSAGFFGSVGCPTDTFDLFVYLAKHRDSNGIRAMELSARALAQIL
FT                   QLNAGDTTDRNLATTVYRGAAAIMAFSRAGMATGGDPSASTYHCNVVSSMVDRACDAIA
FT                   EIPSTSRFYVHLATPAYLIGMSASTARQCEIIRGYWRNCQSCEFPRYPDAEAQCDRRWR
FT                   ICGVGFSVG"
     MKGKKPRGIR HDRDCGRCKV RGIKCDLNRP RCQACLQGGE ACNYPQRVVW VDDKKPKRPK        60
     GTSPQIHNAE TPNVEAYKSA SINLYGFIDL LDAFCQQIQS SSRDIPEEGI QLISRTLSFA       120
     RSRVQDANNK ESLQSHLVAL TNLSQVIQSA HPIALFGIAT FAMFEVCCGS FGNWHCHLQG       180
     ARSLLDLHCQ HKADLDDLCG EISGLADVLA YLVWFDVTGA LVRESPLIFE DWHRETLSAG       240
     FFGSVGCPTD TFDLFVYLAK HRDSNGIRAM ELSARALAQI LQLNAGDTTD RNLATTVYRG       300
     AAAIMAFSRA GMATGGDPSA STYHCNVVSS MVDRACDAIA EIPSTSRFYV HLATPAYLIG       360
     MSASTARQCE IIRGYWRNCQ SCEFPRYPDA EAQCDRRWRI CGVGFSVG                    408
//

If you have problems or comments...

PBIL Back to PBIL home page