(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE365

PENCW_16.PE365       Location/Qualifiers
FT   CDS             join(complement(838224..839439),complement(837959..838089))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948886"
FT                   /orf_name="Pc20g03650"
FT                   /product="Pc20g03650 protein"
FT                   /protein_id="CAP85694.1"
FT                   /db_xref="UniParc:UPI00018311F9"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGS8"
FT                   /transl_table=1
FT                   /translation="MQYPTPVPVFVQTSHPPPPTFLARPRPKFCILRPGGFWTPLIPLD
FT                   ELPSWLEICNWAPDMYMGMYPASMTFMPREGEYDVVCHHCSHGVDSLHQSVSEREASSV
FT                   TASNAASSKDCHEQHASPNAQHHDTVSLPAVLHRDSPNHFLEQPPFSAILQTPFVGMCV
FT                   VDVNSQYPDIAPDQAGPKRRMSLENSIPPQVFGAVGVGSPPLSVANSANARRPDTPYPH
FT                   AHGPGSFAKPQRVASLQNESVASMKSGSVASTRSLTVAAIEQMKRMRRRRLSRGSSLHA
FT                   SISVPEAKSLSQVSDSKISKVSKVSKNSKISKLSRISRVSGVSKISSIRVISKHSPKVV
FT                   LRRRRAEERKARKSAQAVTSMEKPEQVNSATKRRDRRERMMQRRRQSDRGKQPYANMMR
FT                   IPNWSPDRCLSFILFMLGLAMSSVIPDCPFLRLVILLFSADVRLVIVSR"
     MQYPTPVPVF VQTSHPPPPT FLARPRPKFC ILRPGGFWTP LIPLDELPSW LEICNWAPDM        60
     YMGMYPASMT FMPREGEYDV VCHHCSHGVD SLHQSVSERE ASSVTASNAA SSKDCHEQHA       120
     SPNAQHHDTV SLPAVLHRDS PNHFLEQPPF SAILQTPFVG MCVVDVNSQY PDIAPDQAGP       180
     KRRMSLENSI PPQVFGAVGV GSPPLSVANS ANARRPDTPY PHAHGPGSFA KPQRVASLQN       240
     ESVASMKSGS VASTRSLTVA AIEQMKRMRR RRLSRGSSLH ASISVPEAKS LSQVSDSKIS       300
     KVSKVSKNSK ISKLSRISRV SGVSKISSIR VISKHSPKVV LRRRRAEERK ARKSAQAVTS       360
     MEKPEQVNSA TKRRDRRERM MQRRRQSDRG KQPYANMMRI PNWSPDRCLS FILFMLGLAM       420
     SSVIPDCPFL RLVILLFSAD VRLVIVSR                                          448
//

If you have problems or comments...

PBIL Back to PBIL home page