(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE368

PENCW_16.PE368       Location/Qualifiers
FT   CDS             844585..844896
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948888"
FT                   /orf_name="Pc20g03680"
FT                   /product="Pc20g03680 protein"
FT                   /protein_id="CAP85697.1"
FT                   /db_xref="UniParc:UPI00018311FC"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGT1"
FT                   /transl_table=1
FT                   /translation="MSIATGENETGGRSATVGQLETHGLTPAEKHYWATELEISCLVWV
FT                   VRKIRHMVEAAPDDLTPVAYTDHIATINLATSLSSASPDRMNLRLVRASQYLQQTGTS"
     MSIATGENET GGRSATVGQL ETHGLTPAEK HYWATELEIS CLVWVVRKIR HMVEAAPDDL        60
     TPVAYTDHIA TINLATSLSS ASPDRMNLRL VRASQYLQQT GTS                         103
//

If you have problems or comments...

PBIL Back to PBIL home page