(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE369

PENCW_16.PE369       Location/Qualifiers
FT   CDS             complement(845718..846896)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195760" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671929"
FT                   /orf_name="Pc20g03690"
FT                   /product="Pc20g03690 protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAP85698.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI00018311FD"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGT2"
FT                   /transl_table=1
FT                   /translation="MANPPVQLSLQTTQGKSPSTQVPSSLTPPVTPIAKERPPRSTPSP
FT                   IQDPKAAQTPSTSKDNVGTLQFTDDLEICHDENNRSLEFGRGVWSIVYKARSFPHPQTN
FT                   PPGTPPSSPTSRSQVLAVKAPLRRDARPVLNAEASTLTRLTFTQGHEQYIVPFHGYHAP
FT                   LGALVMSAIPTSLASYIEDQSKQARTHHTTATMFDPVQGPASYQDLARRLITGLNWLHQ
FT                   VAAVVHGDIKPHNILLRPIDTDDCVEAPAFPFQPLYADFSATVDIPVHAEARDTTRASM
FT                   SSFTPPFTAPEMLASLTSTEMAPTPASDVFSLAATLLAIATGDLLLYPNMNHRLRLEMA
FT                   RAGHQIVDFARSGVSGSRVPRNGFVERIVKPAVVKDPAMRITTPEWVQLASC"
     MANPPVQLSL QTTQGKSPST QVPSSLTPPV TPIAKERPPR STPSPIQDPK AAQTPSTSKD        60
     NVGTLQFTDD LEICHDENNR SLEFGRGVWS IVYKARSFPH PQTNPPGTPP SSPTSRSQVL       120
     AVKAPLRRDA RPVLNAEAST LTRLTFTQGH EQYIVPFHGY HAPLGALVMS AIPTSLASYI       180
     EDQSKQARTH HTTATMFDPV QGPASYQDLA RRLITGLNWL HQVAAVVHGD IKPHNILLRP       240
     IDTDDCVEAP AFPFQPLYAD FSATVDIPVH AEARDTTRAS MSSFTPPFTA PEMLASLTST       300
     EMAPTPASDV FSLAATLLAI ATGDLLLYPN MNHRLRLEMA RAGHQIVDFA RSGVSGSRVP       360
     RNGFVERIVK PAVVKDPAMR ITTPEWVQLA SC                                     392
//

If you have problems or comments...

PBIL Back to PBIL home page