(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE370

PENCW_16.PE370       Location/Qualifiers
FT   CDS             complement(847788..849698)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195771" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977861"
FT                   /orf_name="Pc20g03700"
FT                   /product="Pc20g03700 protein"
FT                   /function="rRNA (adenine-N6,N6-)-dimethyltransferase
FT                   activity"
FT                   /protein_id="CAP85699.1"
FT                   /db_xref="GO:0000179"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="UniParc:UPI00018311FE"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGT3"
FT                   /transl_table=1
FT                   /translation="MPKIATARTPLARFPLTKKLHPLISRQVGKNRARTQYVSEGLIGK
FT                   SRDPNLIMATNLLLDPADNVLERVSPYLRRNQPLDILDLWPGGGLISSKVNELLQPRRH
FT                   VLVEPDPRFNDFLQPLAQSNPCYKLVDEPIYGKFDWSYFFATHLPEQGRGNQENSAIIP
FT                   KNDSLLILANLPAARSGMDHFKPSRWFLNYMKNCLKQKDVNLYGAVRVLATMPSSEVSD
FT                   MLPRSAMERTRTGVFAETIGLHNIEVASPAEEERSHQWRGWNDLNKTRERVAETAAANN
FT                   IITPPTRELPPLEVVPHVPYRTSRVERPYQPRVLTQMHKKQLMDIAEADKLGLDSCSDT
FT                   TDPKAKAIIRKRALAWTKLARDNSATYFRQQLVDVILEQDQVGWTFARAAADPEESVES
FT                   LKAIEDRMVSLKSSYATLKSSIHHTMLEKHQHAIDDVRLGRLANHFVDVGLTHEQRPYE
FT                   PLYIHPDETYPRGDGRAVIYFEPDSNPPSLKKTFDLPSTTVQLVLDRYLAMLAVVGTRG
FT                   TMPVAEFLKTLFPTESINSHVRDIPSLASFAERRLKPGRGPMPLPEGSTSDPAFTYQDN
FT                   VDYDLSDVRLRTLSAATLLDIAVKYEKLPEKLGIIAFSRALGGTMTQAQIGEELLNMRL
FT                   R"
     MPKIATARTP LARFPLTKKL HPLISRQVGK NRARTQYVSE GLIGKSRDPN LIMATNLLLD        60
     PADNVLERVS PYLRRNQPLD ILDLWPGGGL ISSKVNELLQ PRRHVLVEPD PRFNDFLQPL       120
     AQSNPCYKLV DEPIYGKFDW SYFFATHLPE QGRGNQENSA IIPKNDSLLI LANLPAARSG       180
     MDHFKPSRWF LNYMKNCLKQ KDVNLYGAVR VLATMPSSEV SDMLPRSAME RTRTGVFAET       240
     IGLHNIEVAS PAEEERSHQW RGWNDLNKTR ERVAETAAAN NIITPPTREL PPLEVVPHVP       300
     YRTSRVERPY QPRVLTQMHK KQLMDIAEAD KLGLDSCSDT TDPKAKAIIR KRALAWTKLA       360
     RDNSATYFRQ QLVDVILEQD QVGWTFARAA ADPEESVESL KAIEDRMVSL KSSYATLKSS       420
     IHHTMLEKHQ HAIDDVRLGR LANHFVDVGL THEQRPYEPL YIHPDETYPR GDGRAVIYFE       480
     PDSNPPSLKK TFDLPSTTVQ LVLDRYLAML AVVGTRGTMP VAEFLKTLFP TESINSHVRD       540
     IPSLASFAER RLKPGRGPMP LPEGSTSDPA FTYQDNVDYD LSDVRLRTLS AATLLDIAVK       600
     YEKLPEKLGI IAFSRALGGT MTQAQIGEEL LNMRLR                                 636
//

If you have problems or comments...

PBIL Back to PBIL home page