(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE371

PENCW_16.PE371       Location/Qualifiers
FT   CDS             join(850049..850195,850276..851769)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195792" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977862"
FT                   /orf_name="Pc20g03710"
FT                   /product="Pc20g03710 protein"
FT                   /protein_id="CAP85700.1"
FT                   /db_xref="InterPro:IPR000555"
FT                   /db_xref="UniParc:UPI00018311FF"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGT4"
FT                   /transl_table=1
FT                   /translation="MPSNATGGATGATAPQSVENITRIAQNYEYNSSVPLRYWLRTATT
FT                   LLREARIYEREGHDEQAYLILFRHAQLILVHLSKHPDTKKNEEDRKALVAAEKEVEKNL
FT                   SKLEILRPRINKRYERYTQLMRERESRKQPSRTKIVAEPREQVADPALAGVAEPLEAGE
FT                   NRDLAVQLAQSELNRRATVRDSKSLSGPSAEELETRRAAGVWGDWDHSIKSESRAGDRD
FT                   LGQRVQDISSKPDHTDGPYGQRAKEPVVPSSATSTYNYPTVPRQRPLEPAVSPGNIAIL
FT                   DKNVERQAPPILPPKEHLEPSRASIVNDSATDLAPARPAKVLPGPALPEKIRPSEQATA
FT                   TRSDLDPSSYTFKPSAYLENGTPLRSVFLPANLRSRFLSLVAPNTRANLETCGILCGTL
FT                   VSNALFISKLVIPEQTSTSDTCETVNESALFDYCDSEDLMTLGWIHTHPSQTCFMSSRD
FT                   LHTHCGYQVMLPESIAIVCAPSKSPDWGVFRLTDPPGLKSVLNCHQTGLFHPHAEENIY
FT                   TGALRPGHVFEVSGLEFETVDLRPGSLKN"
     MPSNATGGAT GATAPQSVEN ITRIAQNYEY NSSVPLRYWL RTATTLLREA RIYEREGHDE        60
     QAYLILFRHA QLILVHLSKH PDTKKNEEDR KALVAAEKEV EKNLSKLEIL RPRINKRYER       120
     YTQLMRERES RKQPSRTKIV AEPREQVADP ALAGVAEPLE AGENRDLAVQ LAQSELNRRA       180
     TVRDSKSLSG PSAEELETRR AAGVWGDWDH SIKSESRAGD RDLGQRVQDI SSKPDHTDGP       240
     YGQRAKEPVV PSSATSTYNY PTVPRQRPLE PAVSPGNIAI LDKNVERQAP PILPPKEHLE       300
     PSRASIVNDS ATDLAPARPA KVLPGPALPE KIRPSEQATA TRSDLDPSSY TFKPSAYLEN       360
     GTPLRSVFLP ANLRSRFLSL VAPNTRANLE TCGILCGTLV SNALFISKLV IPEQTSTSDT       420
     CETVNESALF DYCDSEDLMT LGWIHTHPSQ TCFMSSRDLH THCGYQVMLP ESIAIVCAPS       480
     KSPDWGVFRL TDPPGLKSVL NCHQTGLFHP HAEENIYTGA LRPGHVFEVS GLEFETVDLR       540
     PGSLKN                                                                  546
//

If you have problems or comments...

PBIL Back to PBIL home page