(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE372

PENCW_16.PE372       Location/Qualifiers
FT   CDS             join(852281..853272,853328..853472)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195803" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948889"
FT                   /orf_name="Pc20g03720"
FT                   /product="Pc20g03720 protein"
FT                   /protein_id="CAP85701.1"
FT                   /db_xref="InterPro:IPR006571"
FT                   /db_xref="UniParc:UPI0001831200"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGT5"
FT                   /transl_table=1
FT                   /translation="MSSTSENIPSDTPTSSTSTGSASQPTEKPPYQSASYFSYPVTHVV
FT                   SGLYRRITDPDLAKEMPSVMPWSRSSSSSEVFTPRRTASPFQPPPLTPLTLEIPTGADL
FT                   LQQRLLTRALAEEIRLLVPPRLQLAETWRLAYSLDRDGASLSTLYENCAQFSHRSPRAG
FT                   YVLVIRDSSPSSSVFGAYMTDAPHPDSQFYGTGECFLWRASVLPPPASFPLVLPGEGPQ
FT                   SEEALERAGLPPPPSADTTTAGRWSTLRNDKSKPPRAESPAHNLNMNIKTNLAAASGGV
FT                   LAPPSPSSIHTPSRSGASTPERIRFKAFPYSGVNDYMIFCETGFLSLGGGDGHYGLWLD
FT                   SSLEKGVSASCQTFGNEPLSDEGVKFDVLGVEVWYVGS"
     MSSTSENIPS DTPTSSTSTG SASQPTEKPP YQSASYFSYP VTHVVSGLYR RITDPDLAKE        60
     MPSVMPWSRS SSSSEVFTPR RTASPFQPPP LTPLTLEIPT GADLLQQRLL TRALAEEIRL       120
     LVPPRLQLAE TWRLAYSLDR DGASLSTLYE NCAQFSHRSP RAGYVLVIRD SSPSSSVFGA       180
     YMTDAPHPDS QFYGTGECFL WRASVLPPPA SFPLVLPGEG PQSEEALERA GLPPPPSADT       240
     TTAGRWSTLR NDKSKPPRAE SPAHNLNMNI KTNLAAASGG VLAPPSPSSI HTPSRSGAST       300
     PERIRFKAFP YSGVNDYMIF CETGFLSLGG GDGHYGLWLD SSLEKGVSAS CQTFGNEPLS       360
     DEGVKFDVLG VEVWYVGS                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page