(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE373

PENCW_16.PE373       Location/Qualifiers
FT   CDS             join(complement(855209..857125),complement(854456..855142))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000180546" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824641"
FT                   /orf_name="Pc20g03730"
FT                   /product="Pc20g03730 protein"
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /protein_id="CAP85702.1"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="InterPro:IPR000375"
FT                   /db_xref="InterPro:IPR001401"
FT                   /db_xref="InterPro:IPR020850"
FT                   /db_xref="InterPro:IPR022812"
FT                   /db_xref="UniParc:UPI0001831201"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGT6"
FT                   /transl_table=1
FT                   /translation="MAGSAEFGGPPRQLRPDQVPLLLNTIDKLRSIGVGEHVELPQMII
FT                   CGSKANAKRSVIESISRIRFPVRKDFHNGFVTEITLRRHATTRFQVSVEPGPSSSKSQL
FT                   DIQELKGSMVTAPNAEQSVSLIEKATGFVKPSLEDGFSEDVMRVELSGPDQPNLTLIDI
FT                   PRLYFTEGIDDENKDKCAGHLQIEKYVRNPRTIILAVVSAKIDICAQKINDFADKYDRG
FT                   RSRILGIITHLDTLEESSDEEKLWQMAVKEEISQQPLGLHLVWTRSSESRDVPDEQRDQ
FT                   KEKEFLERGDWKTVPRESVGTDNLRSRLSTLFVNHVQSSLPRLISEINQRTRKIQSNMS
FT                   KLRTPRETIHQQKALLVNLGSDFHRITSQALTGMYIDDFFDTRVDDDQPTTRDPRRLRA
FT                   MIRALNEDFADVMDIAGCRQFIHGVNNQVTSLLNPCNPYANIRQPVHKSRMEFELDVLE
FT                   IMCRDRGLEFPGNINQLVLANLFRDQSEPWADIARAHVKKSWETIREFVSLLMDHLADE
FT                   HMSAVIIRTVIQPQLDRMHASLLGKVLELTAANKRGHALPLSRSFLRGHPLPLDRSFLA
FT                   RMQKSRNDRVLAHLQQSLPSSLPSNFSTTYNMGEIRAATQSMESSSNPFVASDLIDQFQ
FT                   AYYNNALGVFTDNITTLGIENCLLDPLNDLLTTRKITEMEDSQIEDLFAGVQNGVEDQG
FT                   HDPGDELKLLQTAVRVLDQFKIAPSTGAIKSPGLSSAHGRSSLQPYLIPQGIICNGASA
FT                   NPFGVLCVDSRVQGQNNTPRYQISWPYSQAPDMQNSTTPCPSGPFGLNPGTMNPGTVSV
FT                   PSVSAPTVNAAPTSGVPGFAGPTPPLPQTVTSSPFCSLRAGPDLFGTPDTSSHDA"
     MAGSAEFGGP PRQLRPDQVP LLLNTIDKLR SIGVGEHVEL PQMIICGSKA NAKRSVIESI        60
     SRIRFPVRKD FHNGFVTEIT LRRHATTRFQ VSVEPGPSSS KSQLDIQELK GSMVTAPNAE       120
     QSVSLIEKAT GFVKPSLEDG FSEDVMRVEL SGPDQPNLTL IDIPRLYFTE GIDDENKDKC       180
     AGHLQIEKYV RNPRTIILAV VSAKIDICAQ KINDFADKYD RGRSRILGII THLDTLEESS       240
     DEEKLWQMAV KEEISQQPLG LHLVWTRSSE SRDVPDEQRD QKEKEFLERG DWKTVPRESV       300
     GTDNLRSRLS TLFVNHVQSS LPRLISEINQ RTRKIQSNMS KLRTPRETIH QQKALLVNLG       360
     SDFHRITSQA LTGMYIDDFF DTRVDDDQPT TRDPRRLRAM IRALNEDFAD VMDIAGCRQF       420
     IHGVNNQVTS LLNPCNPYAN IRQPVHKSRM EFELDVLEIM CRDRGLEFPG NINQLVLANL       480
     FRDQSEPWAD IARAHVKKSW ETIREFVSLL MDHLADEHMS AVIIRTVIQP QLDRMHASLL       540
     GKVLELTAAN KRGHALPLSR SFLRGHPLPL DRSFLARMQK SRNDRVLAHL QQSLPSSLPS       600
     NFSTTYNMGE IRAATQSMES SSNPFVASDL IDQFQAYYNN ALGVFTDNIT TLGIENCLLD       660
     PLNDLLTTRK ITEMEDSQIE DLFAGVQNGV EDQGHDPGDE LKLLQTAVRV LDQFKIAPST       720
     GAIKSPGLSS AHGRSSLQPY LIPQGIICNG ASANPFGVLC VDSRVQGQNN TPRYQISWPY       780
     SQAPDMQNST TPCPSGPFGL NPGTMNPGTV SVPSVSAPTV NAAPTSGVPG FAGPTPPLPQ       840
     TVTSSPFCSL RAGPDLFGTP DTSSHDA                                           867
//

If you have problems or comments...

PBIL Back to PBIL home page