(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE375

PENCW_16.PE375       Location/Qualifiers
FT   CDS             join(860040..860188,860249..860510)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948890"
FT                   /orf_name="Pc20g03750"
FT                   /product="Putative uncharacterized protein Pc20g03750 "
FT                   /protein_id="CAP85704.1"
FT                   /db_xref="UniParc:UPI0001831202"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGT8"
FT                   /transl_table=1
FT                   /translation="MDFVDDNDKVLGKAEVVSNYFGLSSLNALPKHLMGRIVSIATSST
FT                   SLVKRSPRVSRETAMSFLRTFRGLVNFVHLVFSSCPLSIAIHPSTLPGSIEAHLVGNLK
FT                   AKLLIGMDVMGHEAFRLDLDAKKTTELLMYGH"
     MDFVDDNDKV LGKAEVVSNY FGLSSLNALP KHLMGRIVSI ATSSTSLVKR SPRVSRETAM        60
     SFLRTFRGLV NFVHLVFSSC PLSIAIHPST LPGSIEAHLV GNLKAKLLIG MDVMGHEAFR       120
     LDLDAKKTTE LLMYGH                                                       136
//

If you have problems or comments...

PBIL Back to PBIL home page