(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE376

PENCW_16.PE376       Location/Qualifiers
FT   CDS             join(complement(862786..863698),complement(862307..862733),
FT                   complement(861967..862255),complement(861458..861907))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234989" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128993"
FT                   /orf_name="Pc20g03760"
FT                   /product="Pc20g03760 protein"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP85705.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0001831203"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGT9"
FT                   /transl_table=1
FT                   /translation="MSAPTTRRNRALASCEPCRERKSRCDHGKPICASCQRRGLDSRCY
FT                   YHPAPLSKNRSARRPTMLTLPRSTLATPSWSRNNTKGCQAHPGRSAAGPPKFHTWPFMS
FT                   TVSDTLPQTPTPGSHDSKAYEAHLATMKEIVSQLRYLPVIEKCLHQYYSFKHNALVPKP
FT                   VVLQILDTLRTDLVSSGHILGEKGEQVELGDISEISETVLLSSSTEVIITPSLDLHGFC
FT                   ALFCGANLRVETIGLLYTMAARASVFFVDRDEDKDGAFVQDMVWYSTLALRLARDLAPQ
FT                   STDVIIWLANENAELRSFLEGDASLGVWRLVGDLTTDLLALGLNREATYSPERTPFFLA
FT                   ECRRRCFVTEYYLEKMFGLVFNLPPRITSRYVDVKLPLDLSDDEIFAQTPEELEEAKDR
FT                   LTEDGWNTDGKLRAATYARLRYILSQFREGIVEYHFQASQAADPAQLRDLSSQCRQTWD
FT                   NLLPHLRYTQDCWESDMPFTTCYMHAKIHLAYLQIHFQIYHLLGEDSSSPLPELLDVSA
FT                   NILETVVQMGISRRKGAFTFNDLPLILLSCGLPSAAVLSTALENITQDPSRVLPPGIKT
FT                   PAVIRNLSVLASQLDSVASSRERNQAFCLQAAKAITEKLDKILDKFATSKFQATPDVAT
FT                   STDVSPMSVLATDVDSPLDDGAGEIGAINLDDYDNFDLMSWAIDFDLGNTASDWTMM"
     MSAPTTRRNR ALASCEPCRE RKSRCDHGKP ICASCQRRGL DSRCYYHPAP LSKNRSARRP        60
     TMLTLPRSTL ATPSWSRNNT KGCQAHPGRS AAGPPKFHTW PFMSTVSDTL PQTPTPGSHD       120
     SKAYEAHLAT MKEIVSQLRY LPVIEKCLHQ YYSFKHNALV PKPVVLQILD TLRTDLVSSG       180
     HILGEKGEQV ELGDISEISE TVLLSSSTEV IITPSLDLHG FCALFCGANL RVETIGLLYT       240
     MAARASVFFV DRDEDKDGAF VQDMVWYSTL ALRLARDLAP QSTDVIIWLA NENAELRSFL       300
     EGDASLGVWR LVGDLTTDLL ALGLNREATY SPERTPFFLA ECRRRCFVTE YYLEKMFGLV       360
     FNLPPRITSR YVDVKLPLDL SDDEIFAQTP EELEEAKDRL TEDGWNTDGK LRAATYARLR       420
     YILSQFREGI VEYHFQASQA ADPAQLRDLS SQCRQTWDNL LPHLRYTQDC WESDMPFTTC       480
     YMHAKIHLAY LQIHFQIYHL LGEDSSSPLP ELLDVSANIL ETVVQMGISR RKGAFTFNDL       540
     PLILLSCGLP SAAVLSTALE NITQDPSRVL PPGIKTPAVI RNLSVLASQL DSVASSRERN       600
     QAFCLQAAKA ITEKLDKILD KFATSKFQAT PDVATSTDVS PMSVLATDVD SPLDDGAGEI       660
     GAINLDDYDN FDLMSWAIDF DLGNTASDWT MM                                     692
//

If you have problems or comments...

PBIL Back to PBIL home page