(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE377

PENCW_16.PE377       Location/Qualifiers
FT   CDS             join(complement(865022..865032),complement(864279..864903))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000168708" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824642"
FT                   /orf_name="Pc20g03770"
FT                   /product="Pc20g03770 protein"
FT                   /function="N-acetyltransferase activity"
FT                   /protein_id="CAP85706.1"
FT                   /db_xref="GO:0008080"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI0001831204"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGU0"
FT                   /transl_table=1
FT                   /translation="MASNTINNEVHDMTIVRGTVDTVPAVLHLLDTAVQWLVSHDRTGQ
FT                   WGAAPFSENPQRTEQLREFATTGHGLWLAIKVANNTPILCQNRISNIKPQTMNGEAPGV
FT                   IVGALALGERTPYVTPVSEPELYVRLLVTDRQCAGNQIGKRLLDHARDLASKAGVSLLR
FT                   VDCYAGGDGKLVQYYESQGFKRFESLDVEGKWPCQVLAQWLDEIEGES"
     MASNTINNEV HDMTIVRGTV DTVPAVLHLL DTAVQWLVSH DRTGQWGAAP FSENPQRTEQ        60
     LREFATTGHG LWLAIKVANN TPILCQNRIS NIKPQTMNGE APGVIVGALA LGERTPYVTP       120
     VSEPELYVRL LVTDRQCAGN QIGKRLLDHA RDLASKAGVS LLRVDCYAGG DGKLVQYYES       180
     QGFKRFESLD VEGKWPCQVL AQWLDEIEGE S                                      211
//

If you have problems or comments...

PBIL Back to PBIL home page