(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE380

PENCW_16.PE380       Location/Qualifiers
FT   CDS             complement(871924..873156)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195825" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671930"
FT                   /orf_name="Pc20g03800"
FT                   /product="Pc20g03800 protein"
FT                   /protein_id="CAP85709.1"
FT                   /db_xref="InterPro:IPR007356"
FT                   /db_xref="InterPro:IPR016009"
FT                   /db_xref="UniParc:UPI00018312D9"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGU3"
FT                   /transl_table=1
FT                   /translation="MEEQERPRKLAKLDHDEDTTNEVLGPAMTGAGDVAGKEPEPASAQ
FT                   IGNEPLDLTEFTVQKDTKTDNEPTTQDGAEAAAPVMSKNQMKKLRRAEAHQQKRALQKA
FT                   QKKEKIIEKRERRKAMIEEARAKGDEEAVNKLRALWRGKKAKHIKSTLIPLTFVMDCGY
FT                   DELMSDRERISLAGQLTRSYSDNSRAPYSGHMMFSSFDKLLKERFDTILTSHKNWKRVR
FT                   FLQEDFVRAGELAKEDMAAPRGGQLAGPFAEQTDAKPEDGEIIYLSSDSENTLTELKPY
FT                   STYIVGALVDKNRYKAVCYKQAVAKGIKTAKLPIGQYIQMAHRPVLATNHVIEIMLQWL
FT                   ELRDWGKAFMKVIPTRKGGALKGTQGEDEDDAENGDEDVNEEDMEAEQMEQLEEIAALE
FT                   EGSEDENAEKR"
     MEEQERPRKL AKLDHDEDTT NEVLGPAMTG AGDVAGKEPE PASAQIGNEP LDLTEFTVQK        60
     DTKTDNEPTT QDGAEAAAPV MSKNQMKKLR RAEAHQQKRA LQKAQKKEKI IEKRERRKAM       120
     IEEARAKGDE EAVNKLRALW RGKKAKHIKS TLIPLTFVMD CGYDELMSDR ERISLAGQLT       180
     RSYSDNSRAP YSGHMMFSSF DKLLKERFDT ILTSHKNWKR VRFLQEDFVR AGELAKEDMA       240
     APRGGQLAGP FAEQTDAKPE DGEIIYLSSD SENTLTELKP YSTYIVGALV DKNRYKAVCY       300
     KQAVAKGIKT AKLPIGQYIQ MAHRPVLATN HVIEIMLQWL ELRDWGKAFM KVIPTRKGGA       360
     LKGTQGEDED DAENGDEDVN EEDMEAEQME QLEEIAALEE GSEDENAEKR                  410
//

If you have problems or comments...

PBIL Back to PBIL home page