(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE381

PENCW_16.PE381       Location/Qualifiers
FT   CDS             join(873379..873429,873525..873604,873760..873912,
FT                   873986..874034)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195836" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948892"
FT                   /orf_name="Pc20g03810"
FT                   /product="Pc20g03810 protein"
FT                   /protein_id="CAP85710.1"
FT                   /db_xref="InterPro:IPR009346"
FT                   /db_xref="UniParc:UPI00018312DA"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGU4"
FT                   /transl_table=1
FT                   /translation="MPQDMPPTGGYAQVQYKRNIPARGFKPAYYMIGMHVIMAYGFYNE
FT                   LAREKMWSRLHLTPLLQAEEDRDQVRRHYADKAREKELLGTDAKVYNSDRFIRPTFAYT
FT                   PANLTQ"
     MPQDMPPTGG YAQVQYKRNI PARGFKPAYY MIGMHVIMAY GFYNELAREK MWSRLHLTPL        60
     LQAEEDRDQV RRHYADKARE KELLGTDAKV YNSDRFIRPT FAYTPANLTQ                  110
//

If you have problems or comments...

PBIL Back to PBIL home page