(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE382

PENCW_16.PE382       Location/Qualifiers
FT   CDS             join(complement(877307..878795),complement(877128..877252),
FT                   complement(877006..877077),complement(876726..876950),
FT                   complement(876566..876669),complement(876248..876506),
FT                   complement(876048..876190),complement(875396..875991),
FT                   complement(874638..875323))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195837" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948893"
FT                   /orf_name="Pc20g03820"
FT                   /product="Pc20g03820 protein"
FT                   /function="binding"
FT                   /protein_id="CAP85711.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013598"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI00018312DB"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGU5"
FT                   /transl_table=1
FT                   /translation="MAAEELSEGGMADIIRALQLIHNPASSNDIRKEASQFVENLKESD
FT                   AAARNGFLLASRMEHEPVVRYFGLTLLDHVLRQYNFTNPEEAKNLRMMILQLAENVRPE
FT                   DPAYFRNKISQLWTEAAKKTWGLDWMDMDANLVQFWGASLVHKELVLAVLETLSEDVFF
FT                   REDTASSLRGGELNRSLVEIFTPAGIVEQITGDKTTATIPRCGQEGWLVRICEFLDNCV
FT                   QNVSSSEQARDAATKALATLRSALSWSVYKGVIASQVVPSIFRALPCQDDQVLLSAVEA
FT                   LHALYGRNTIGSEDSQELVCLIFQPVYLVVLQRLYEWSIVGPDDVDEPKYLISKKLSEM
FT                   ISYIAGCLEDDKFLVSTMDRLNLPPFLQFMVNIMQHQSLTVSIPCLHLWSRLLQNSKIS
FT                   NLDFVVEQTPQFLNICTQRLLRWESLPTESEDPTVQFLVEDIDTVPERHAFVGNYRRYC
FT                   SSIIETITFKRPQEAVREILARVDTNLDNLYNGVQPFSMATFSKSSIPLMRADAQFAVV
FT                   EAVIKGYNKWISAHGKAPQRDESKRMELEHAVENWASTLMQKSFEDPVLKQRVIKLVVD
FT                   ISSKALDNHQGFALKVLEHILMSRLPDRSEYPLYSEAVKELHGLASSELRRLAMRYADY
FT                   FYTFYDLLEPKIKEITLANRIDDKLQMELTSILLIIMQRAINADPYLRQNRLASFLQPI
FT                   QEAWQDDQFRHSSSTFPGFCNMLGLENVGPYMQSKEAQKLADWSEVALDNEGRLVQEEM
FT                   TRKFQLLPLRGTKTMLAVSTDRVKKSSPAYATACQMWHELIPIILPTLLQLVRNAHAFH
FT                   NPANWNMVEGMQPVVERILTDRFWQAGISIGSRDEFYARITSSKSTLEGFASSVRGKVR
FT                   AVREACYSMLFSMSRMREHFYGFAELPGPLSEALFVDSPHLSSHQFSVLLNISRCLIDD
FT                   CPVQFRSQFLPPMLSTLFTNIDRKVTTEWEIIEQRRNGISDGDLTTEMKSESVLRQLTY
FT                   SAVIMVASLFDPQRGDPDGTESDPTAPQPTPNLSDSIRHFVLSSPQIFEPVMLFCTHAL
FT                   RMRDTRSGSIITRVIRSILQDFAPTNDTPDTPTIATIREFICTDVLTACISSVHESYFV
FT                   DMQKDLAQLIASIWCLYGFCSETPRAVFLSLPGISAEKVASTESALHQTTSPRQQRALV
FT                   LELLEPLRGISVAEQGKILGSREERRKARSALQERYMTNEMDTQQQNHRVDINDGPDLG
FT                   GVADLFG"
     MAAEELSEGG MADIIRALQL IHNPASSNDI RKEASQFVEN LKESDAAARN GFLLASRMEH        60
     EPVVRYFGLT LLDHVLRQYN FTNPEEAKNL RMMILQLAEN VRPEDPAYFR NKISQLWTEA       120
     AKKTWGLDWM DMDANLVQFW GASLVHKELV LAVLETLSED VFFREDTASS LRGGELNRSL       180
     VEIFTPAGIV EQITGDKTTA TIPRCGQEGW LVRICEFLDN CVQNVSSSEQ ARDAATKALA       240
     TLRSALSWSV YKGVIASQVV PSIFRALPCQ DDQVLLSAVE ALHALYGRNT IGSEDSQELV       300
     CLIFQPVYLV VLQRLYEWSI VGPDDVDEPK YLISKKLSEM ISYIAGCLED DKFLVSTMDR       360
     LNLPPFLQFM VNIMQHQSLT VSIPCLHLWS RLLQNSKISN LDFVVEQTPQ FLNICTQRLL       420
     RWESLPTESE DPTVQFLVED IDTVPERHAF VGNYRRYCSS IIETITFKRP QEAVREILAR       480
     VDTNLDNLYN GVQPFSMATF SKSSIPLMRA DAQFAVVEAV IKGYNKWISA HGKAPQRDES       540
     KRMELEHAVE NWASTLMQKS FEDPVLKQRV IKLVVDISSK ALDNHQGFAL KVLEHILMSR       600
     LPDRSEYPLY SEAVKELHGL ASSELRRLAM RYADYFYTFY DLLEPKIKEI TLANRIDDKL       660
     QMELTSILLI IMQRAINADP YLRQNRLASF LQPIQEAWQD DQFRHSSSTF PGFCNMLGLE       720
     NVGPYMQSKE AQKLADWSEV ALDNEGRLVQ EEMTRKFQLL PLRGTKTMLA VSTDRVKKSS       780
     PAYATACQMW HELIPIILPT LLQLVRNAHA FHNPANWNMV EGMQPVVERI LTDRFWQAGI       840
     SIGSRDEFYA RITSSKSTLE GFASSVRGKV RAVREACYSM LFSMSRMREH FYGFAELPGP       900
     LSEALFVDSP HLSSHQFSVL LNISRCLIDD CPVQFRSQFL PPMLSTLFTN IDRKVTTEWE       960
     IIEQRRNGIS DGDLTTEMKS ESVLRQLTYS AVIMVASLFD PQRGDPDGTE SDPTAPQPTP      1020
     NLSDSIRHFV LSSPQIFEPV MLFCTHALRM RDTRSGSIIT RVIRSILQDF APTNDTPDTP      1080
     TIATIREFIC TDVLTACISS VHESYFVDMQ KDLAQLIASI WCLYGFCSET PRAVFLSLPG      1140
     ISAEKVASTE SALHQTTSPR QQRALVLELL EPLRGISVAE QGKILGSREE RRKARSALQE      1200
     RYMTNEMDTQ QQNHRVDIND GPDLGGVADL FG                                    1232
//

If you have problems or comments...

PBIL Back to PBIL home page