(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE384

PENCW_16.PE384       Location/Qualifiers
FT   CDS             join(complement(881595..881978),complement(880284..881534),
FT                   complement(879583..880221))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195848" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948894"
FT                   /orf_name="Pc20g03840"
FT                   /product="Pc20g03840 protein"
FT                   /function="cation binding"
FT                   /function="hydrolase activity, hydrolyzing O-glycosyl
FT                   compounds"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="CAP85713.1"
FT                   /db_xref="GO:0004553"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI00018312DD"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH54"
FT                   /transl_table=1
FT                   /translation="MAPLHLKVEGQTFRDPHNREITLRGINVAADAKYPKTPDVPSYIA
FT                   ENFFDADNVSFVERPFSLEDAHIHFKRLRKWGYNTIRYIFTWEAIEHAGPGVYDHEWVA
FT                   YTIEVLRIAKQYDFWVFMDPHQDVWSRLSGGSGAPMWTLYAAGLNPRTFKDTEAALVQN
FT                   TYDIPAEFPKMIWSTNYTRLVCQTMFTLFWAGRDFAPKAIIDGMNIQDYLQDHFINACA
FT                   FLARRIHEAGDLGEVIIGWESMNEPHRGLVGVQDISVIPPEQQLQLGTSPTAFQAMLTG
FT                   SGKACEQTTWAFGNFGPYKTGTNLVDPAGVIAWLPADQSFNDNQYGWQRDPGWKLGECI
FT                   WAQHGVWDPSTDVLLQKDYFSKKPTGEPLDYEKFTNSYFLDHYRAYKNAIRRIWPDAIM
FT                   FCQPPVMEVPPDIKGTTDDDPNMVHAVHFYDGLTLLTKHWNRLYNVDVIGVLRGKYLTP
FT                   AFALKVGETAIRNCLRDQLKFLRDESRNYMGSHPVVFTEIGIPYDMDDKYAYKTGDYSS
FT                   QTSAMDANHFALEGSTSNGFTLWVYVTQNDHEWGDQWNGEDLSIYSRDDLDLPAGSSTR
FT                   PLDPNSPAFSESQSSGAEAEPNVGPRNLKGVLSTPSISSERSQIPLRQQQGYRAAEAYL
FT                   RPSPTYVSGKLDSHVFDLKNCVFTLSLTAKGATTATAPTEIYLPDFHFPESNIVVTVSG
FT                   GKWDIDVQDIQGAKLQRLRWWHAEGEQDIKIEGLKRKPGEFGNPGGQDVGYLEQCQKGE
FT                   CVMM"
     MAPLHLKVEG QTFRDPHNRE ITLRGINVAA DAKYPKTPDV PSYIAENFFD ADNVSFVERP        60
     FSLEDAHIHF KRLRKWGYNT IRYIFTWEAI EHAGPGVYDH EWVAYTIEVL RIAKQYDFWV       120
     FMDPHQDVWS RLSGGSGAPM WTLYAAGLNP RTFKDTEAAL VQNTYDIPAE FPKMIWSTNY       180
     TRLVCQTMFT LFWAGRDFAP KAIIDGMNIQ DYLQDHFINA CAFLARRIHE AGDLGEVIIG       240
     WESMNEPHRG LVGVQDISVI PPEQQLQLGT SPTAFQAMLT GSGKACEQTT WAFGNFGPYK       300
     TGTNLVDPAG VIAWLPADQS FNDNQYGWQR DPGWKLGECI WAQHGVWDPS TDVLLQKDYF       360
     SKKPTGEPLD YEKFTNSYFL DHYRAYKNAI RRIWPDAIMF CQPPVMEVPP DIKGTTDDDP       420
     NMVHAVHFYD GLTLLTKHWN RLYNVDVIGV LRGKYLTPAF ALKVGETAIR NCLRDQLKFL       480
     RDESRNYMGS HPVVFTEIGI PYDMDDKYAY KTGDYSSQTS AMDANHFALE GSTSNGFTLW       540
     VYVTQNDHEW GDQWNGEDLS IYSRDDLDLP AGSSTRPLDP NSPAFSESQS SGAEAEPNVG       600
     PRNLKGVLST PSISSERSQI PLRQQQGYRA AEAYLRPSPT YVSGKLDSHV FDLKNCVFTL       660
     SLTAKGATTA TAPTEIYLPD FHFPESNIVV TVSGGKWDID VQDIQGAKLQ RLRWWHAEGE       720
     QDIKIEGLKR KPGEFGNPGG QDVGYLEQCQ KGECVMM                                757
//

If you have problems or comments...

PBIL Back to PBIL home page