(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE385

PENCW_16.PE385       Location/Qualifiers
FT   CDS             join(882494..882609,882666..882866,882916..886891)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195859" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948895"
FT                   /orf_name="Pc20g03850"
FT                   /product="Pc20g03850 protein"
FT                   /function="binding"
FT                   /protein_id="CAP85714.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI00018312DE"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH55"
FT                   /transl_table=1
FT                   /translation="MSGKAALKAVRAALESKDFQVAAEKAKELVKNEPNNYHANVFLGL
FT                   ASDRLNKNNDAENAYFAATAINPNDKTAWQGLVSLYEKQGGCQHDGYHNAVIALGMIFA
FT                   ENDEKERCQDLINKYTKSMKSKGTPTQHKHALELQIPGSPLYDFLEGRLPRPSQTYQRL
FT                   IEITERQEREFINREIGERRTRLGARIEQVTQEVRKEAASKSGLDQYYQGMIDWTNDDA
FT                   VRRHYEEKLFQRAYEELGFLPNAAKEEKRAAVFKAAHDMVIIKHPFEPAWKVYLGWLDV
FT                   KDLSQYDVGHLREYIEFFPESGLSQVLKGFLLSDLSPFPRDPSDETQGKDAKDSKETAA
FT                   TQADNEVDDDAPAPQDPFALMVEGLNSARDSILAHRIMAYVYLSFEEYGSVVTVARKGL
FT                   LYVETLVKYSGVEIPNTIDALNNALANALIYYQSPRHHTDAKQIFEGILERNPTSSNCL
FT                   LGIGLILEEDQDYAEAVDFLRRSLERDPSNLKIRGELAWCEALNGDLEGGLASLQATLD
FT                   DLLEAQPDNREFKSELFYRIGYCQWELDPSPTARKDRSGAYASLLASIQTNMNFAPAYT
FT                   ILGFYYADYKKDKARARRCFHKAFELSTSEIEAAERLARDFADSKEWDLVEAIAQRVVD
FT                   SGKARPSPGSKRRGFSWPYAALGSVQVNKQQYSKSIVSFQAALRLAATDYHSWVGLAES
FT                   YHHSGRYNAATKAFEQAKLLEPELSAKDKEHIWFARYMLANVRRELGQYDEAIAAYEDV
FT                   LKSRPDDIGVTLALLQTLTESSTKSLGLGLFNDAADLACQAISVATSLAQNRSDIFNLW
FT                   KAVGDVFSNFSYMKAKAVKLSASSCKTLLAIDLDPMALDVMTDIDGVGTDCLAGNESEE
FT                   SMPSELHVHLPIIAFKRALHVTMHDAHSQAIAWHNLGWAEYLAHRTAQPDLTKKGKKSR
FT                   KFLKAAMRCFKRAIELEAGNPDFWNSLGVVTATMSPKVSQHAFVRSLHLNERNGQVWAN
FT                   LGALYLLHGESYQSYKIFMRAQATDPDYSLAWVGQGFVSLSVGETQEAKGYFEHAFDIS
FT                   NSSDILTKRQFSLAYFDHLTEASSDMSELIQPSFALHQLCIQEPSNLPFVHLSALLAER
FT                   MGETADAESSLQVVCSDMEDEFEKTESPDSLSRYAQANADMARVLLARQSYEEAAEKSE
FT                   LALTLSGEEDAEKFDPEACKKLRLSAHLTAGLAFYNLKSMDKAIDMFRDALEEAGNAPD
FT                   VVCLLAQVLWAKGGEENRSVAREQLLDCVMSNPTHVGAVTLLGAIALLDVDRDAIEAVE
FT                   SDLNSMVSRDDISLHDRAKIIKLLSAISAMGLKDNAALPESIRRMGDATAAVMLTPGQP
FT                   ASWMELSAASQNPYPSAMTIKRALRSVPPYGKLGAEDLSRAYSHTGKVGDALRAIMIAP
FT                   WKRNGWEELTHNVPTPNMWTRSTGHGPE"
     MSGKAALKAV RAALESKDFQ VAAEKAKELV KNEPNNYHAN VFLGLASDRL NKNNDAENAY        60
     FAATAINPND KTAWQGLVSL YEKQGGCQHD GYHNAVIALG MIFAENDEKE RCQDLINKYT       120
     KSMKSKGTPT QHKHALELQI PGSPLYDFLE GRLPRPSQTY QRLIEITERQ EREFINREIG       180
     ERRTRLGARI EQVTQEVRKE AASKSGLDQY YQGMIDWTND DAVRRHYEEK LFQRAYEELG       240
     FLPNAAKEEK RAAVFKAAHD MVIIKHPFEP AWKVYLGWLD VKDLSQYDVG HLREYIEFFP       300
     ESGLSQVLKG FLLSDLSPFP RDPSDETQGK DAKDSKETAA TQADNEVDDD APAPQDPFAL       360
     MVEGLNSARD SILAHRIMAY VYLSFEEYGS VVTVARKGLL YVETLVKYSG VEIPNTIDAL       420
     NNALANALIY YQSPRHHTDA KQIFEGILER NPTSSNCLLG IGLILEEDQD YAEAVDFLRR       480
     SLERDPSNLK IRGELAWCEA LNGDLEGGLA SLQATLDDLL EAQPDNREFK SELFYRIGYC       540
     QWELDPSPTA RKDRSGAYAS LLASIQTNMN FAPAYTILGF YYADYKKDKA RARRCFHKAF       600
     ELSTSEIEAA ERLARDFADS KEWDLVEAIA QRVVDSGKAR PSPGSKRRGF SWPYAALGSV       660
     QVNKQQYSKS IVSFQAALRL AATDYHSWVG LAESYHHSGR YNAATKAFEQ AKLLEPELSA       720
     KDKEHIWFAR YMLANVRREL GQYDEAIAAY EDVLKSRPDD IGVTLALLQT LTESSTKSLG       780
     LGLFNDAADL ACQAISVATS LAQNRSDIFN LWKAVGDVFS NFSYMKAKAV KLSASSCKTL       840
     LAIDLDPMAL DVMTDIDGVG TDCLAGNESE ESMPSELHVH LPIIAFKRAL HVTMHDAHSQ       900
     AIAWHNLGWA EYLAHRTAQP DLTKKGKKSR KFLKAAMRCF KRAIELEAGN PDFWNSLGVV       960
     TATMSPKVSQ HAFVRSLHLN ERNGQVWANL GALYLLHGES YQSYKIFMRA QATDPDYSLA      1020
     WVGQGFVSLS VGETQEAKGY FEHAFDISNS SDILTKRQFS LAYFDHLTEA SSDMSELIQP      1080
     SFALHQLCIQ EPSNLPFVHL SALLAERMGE TADAESSLQV VCSDMEDEFE KTESPDSLSR      1140
     YAQANADMAR VLLARQSYEE AAEKSELALT LSGEEDAEKF DPEACKKLRL SAHLTAGLAF      1200
     YNLKSMDKAI DMFRDALEEA GNAPDVVCLL AQVLWAKGGE ENRSVAREQL LDCVMSNPTH      1260
     VGAVTLLGAI ALLDVDRDAI EAVESDLNSM VSRDDISLHD RAKIIKLLSA ISAMGLKDNA      1320
     ALPESIRRMG DATAAVMLTP GQPASWMELS AASQNPYPSA MTIKRALRSV PPYGKLGAED      1380
     LSRAYSHTGK VGDALRAIMI APWKRNGWEE LTHNVPTPNM WTRSTGHGPE                 1430
//

If you have problems or comments...

PBIL Back to PBIL home page