(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE386

PENCW_16.PE386       Location/Qualifiers
FT   CDS             complement(887144..887878)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195870" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948896"
FT                   /orf_name="Pc20g03860"
FT                   /product="Pc20g03860 protein"
FT                   /protein_id="CAP85715.1"
FT                   /db_xref="InterPro:IPR013894"
FT                   /db_xref="UniParc:UPI00018312DF"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH56"
FT                   /transl_table=1
FT                   /translation="MTSPDQIAAQILSTKSLPVSQTWLNAFLSSSSTAQRNIPASALAK
FT                   SAIFRLLASDIRESLSKHRSYVLPVDIHNPAVQERRLQGSIPVQVLDIEDIGTSLWSQI
FT                   EAIERVERGEAIRGREIVRTIAIGEDPEASENNRANNNPANGAASASGNSGYGPHRLIL
FT                   QDAAGTMVMGIEMQRIDGIALEKLAIGAKLLLRNPSVARGMLLLSPESVTLLGGKIEAL
FT                   DKPWREGRKARLLEKTAGVERE"
     MTSPDQIAAQ ILSTKSLPVS QTWLNAFLSS SSTAQRNIPA SALAKSAIFR LLASDIRESL        60
     SKHRSYVLPV DIHNPAVQER RLQGSIPVQV LDIEDIGTSL WSQIEAIERV ERGEAIRGRE       120
     IVRTIAIGED PEASENNRAN NNPANGAASA SGNSGYGPHR LILQDAAGTM VMGIEMQRID       180
     GIALEKLAIG AKLLLRNPSV ARGMLLLSPE SVTLLGGKIE ALDKPWREGR KARLLEKTAG       240
     VERE                                                                    244
//

If you have problems or comments...

PBIL Back to PBIL home page