(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE387

PENCW_16.PE387       Location/Qualifiers
FT   CDS             888053..888934
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195881" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824645"
FT                   /orf_name="Pc20g03870"
FT                   /product="Pc20g03870 protein"
FT                   /protein_id="CAP85716.1"
FT                   /db_xref="InterPro:IPR014812"
FT                   /db_xref="UniParc:UPI00018312E0"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH57"
FT                   /transl_table=1
FT                   /translation="MSTISSPRPSIASSRAHSPGPTSSRPSLDVLNTNVSGGLSAASTP
FT                   STARALSPSLHPRRNRSALRDYYNLKPPGADSSASRDVSRSRSVPRNTDAGDISDPTAL
FT                   TAGTELDSADFDPQRYVEHLLSTSSLATVLKAENTLVGDIRTLDGERKALVYDNYSKLI
FT                   RAVETIGKMRRSMDDRSAPLTMTKTLGPAIAFVAETAGGLIKEGEEQRRQMKEAKAEDE
FT                   ASSQKNEKDTVRWVLATPQRLEKLVAEDKQEDAEKDWKEIQHLLDVWGDVKGVAEIREA
FT                   CEKVMNRASHDD"
     MSTISSPRPS IASSRAHSPG PTSSRPSLDV LNTNVSGGLS AASTPSTARA LSPSLHPRRN        60
     RSALRDYYNL KPPGADSSAS RDVSRSRSVP RNTDAGDISD PTALTAGTEL DSADFDPQRY       120
     VEHLLSTSSL ATVLKAENTL VGDIRTLDGE RKALVYDNYS KLIRAVETIG KMRRSMDDRS       180
     APLTMTKTLG PAIAFVAETA GGLIKEGEEQ RRQMKEAKAE DEASSQKNEK DTVRWVLATP       240
     QRLEKLVAED KQEDAEKDWK EIQHLLDVWG DVKGVAEIRE ACEKVMNRAS HDD              293
//

If you have problems or comments...

PBIL Back to PBIL home page