(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE388

PENCW_16.PE388       Location/Qualifiers
FT   CDS             complement(889336..890294)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671931"
FT                   /orf_name="Pc20g03880"
FT                   /product="Pc20g03880 protein"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAP85717.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="InterPro:IPR004875"
FT                   /db_xref="InterPro:IPR006600"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniParc:UPI00018312E1"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH58"
FT                   /transl_table=1
FT                   /translation="MPPIRSRSSKESTKXEGRILLAIKAFKNKEIFLIRETTRRFKIPR
FT                   STLSSRLTRIXHRANYRVNSCKLIEIEEESLXKXILSIDSXGLAPRLSIVREIANLLLK
FT                   KRGTTPVLSVGENXVTKYIKRHPLLSSRFSKRYNYERAKYKDLKVIKDXFDLIXKTILQ
FT                   FRIYPDNVYNFNKTGFTIGLIATTKVITRSEYYSRRALLXPRNREXVIAIECTNTASXA
FT                   LLLYLIFKGKVFIKSXFDSLPSDXRFEVSPNSXTTNEIRLRXLKKLFIPTTFIRIKGVY
FT                   RLLILDSYRSYLIPRFNKIYKKNRVILIYIPPYLSYLLQPLDIGYFIVLKRTYRRLVKF
FT                   RIRYGSNYIDKLDFLDSYPTARIEAFKLEIVKNSFXSTGLVPFALERVISKLNIRLTTL
FT                   TPPPSRGSDWDLKIPLNYRQLEKXASSIKALLRTRLGSPLSPLNSAINQVLKAYXITMQ
FT                   SATLLEREVSDLRSETEKKKQKRARSRKYLYAESGLSVXEASALIIQPVEVAEPGPGXH
FT                   SESGLQPRIKPPRGCGVCRKPGHRREICPDR"
     MESTTVVDEI FSDESSFYGK LISDPNPRKP ANQYQATTMR RHNXKHKSHP TTQSHSGXEP        60
     TRSFYQPSSS ICARRHAQRP HHQTFPWTMH PQKQTAYRAT SAGRPSPXLD FYHVFRHQQQ       120
     NLQAXAPGSG CTTRICRRGR REMFPLYLGK AGSFSRSMRM RVRCCARSMI SLVRRLRLPX       180
     LGNXIRCGGS XRGVFLILRG RRVLLVGNGC FFRLLTRLMR SGGLLLELWR RGSLGMWRKL       240
     LLMMVVERVV XFVFIRRISG MLRMLRGLXV SWLILALSGR GPGLFTTSLM RLLIWRLALR       300
     MSMGXRRVCI RVVRCLRGN                                                    319
//

If you have problems or comments...

PBIL Back to PBIL home page