(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE389

PENCW_16.PE389       Location/Qualifiers
FT   CDS             join(complement(892561..892781),complement(892374..892507),
FT                   complement(892023..892295),complement(891715..891925),
FT                   complement(891535..891655),complement(891321..891476),
FT                   complement(891164..891262))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000132894" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671932"
FT                   /orf_name="Pc20g03890"
FT                   /product="Pc20g03890 protein"
FT                   /function="epoxide hydrolase activity"
FT                   /biological_process="response to toxin"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP85718.1"
FT                   /db_xref="GO:0004301"
FT                   /db_xref="GO:0009636"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR010497"
FT                   /db_xref="InterPro:IPR016292"
FT                   /db_xref="UniParc:UPI00018312E2"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH59"
FT                   /transl_table=1
FT                   /translation="MSLPFSTPPSKATASLTPFKATIPQAKLDELETLIKIAKIAPRTY
FT                   ENSQTDHRYGVSTDWLVTMRDRWLKSYNWKSSEDRINSFPQYTTEIEGLTIHFVGLFSK
FT                   RKDAIPLLLLHGWPGSFLEFLPILQRFRDEYTPETLPYHLIVPSLPGYAFSSGPPLDRD
FT                   FGTGDVARVLDQLMKDIGFESGYVVQRGDIGSRIARHLGVDHESCKGQECQYKPVNVVF
FT                   MRKPDGMTDDHLNAFEIEGIERMTKFMTTGAGYAMEHGTRPSTIGHVLSSSPIALLAWI
FT                   GEKFLEWADDPIAPDDILESVTLYWLTETFPRAIYAYRQNYPPPPIPASNDPSWYIHKP
FT                   FGFSSFPMELARLPRSWIETTGDLVFWEQHQKGGHFAALERPDELKADLVKFVDQVWPG
FT                   IAGAK"
     MSLPFSTPPS KATASLTPFK ATIPQAKLDE LETLIKIAKI APRTYENSQT DHRYGVSTDW        60
     LVTMRDRWLK SYNWKSSEDR INSFPQYTTE IEGLTIHFVG LFSKRKDAIP LLLLHGWPGS       120
     FLEFLPILQR FRDEYTPETL PYHLIVPSLP GYAFSSGPPL DRDFGTGDVA RVLDQLMKDI       180
     GFESGYVVQR GDIGSRIARH LGVDHESCKG QECQYKPVNV VFMRKPDGMT DDHLNAFEIE       240
     GIERMTKFMT TGAGYAMEHG TRPSTIGHVL SSSPIALLAW IGEKFLEWAD DPIAPDDILE       300
     SVTLYWLTET FPRAIYAYRQ NYPPPPIPAS NDPSWYIHKP FGFSSFPMEL ARLPRSWIET       360
     TGDLVFWEQH QKGGHFAALE RPDELKADLV KFVDQVWPGI AGAK                        404
//

If you have problems or comments...

PBIL Back to PBIL home page