(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE39

PENCW_16.PE39        Location/Qualifiers
FT   CDS             join(complement(90583..90625),complement(90331..90529),
FT                   complement(89909..90264),complement(89756..89850))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000228249" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946685"
FT                   /orf_name="Pc20g00390"
FT                   /product="Pc20g00390 protein"
FT                   /function="4 iron, 4 sulfur cluster binding"
FT                   /function="NADH dehydrogenase (ubiquinone) activity "
FT                   /function="iron ion binding"
FT                   /function="quinone binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="photosynthesis, light reaction "
FT                   /protein_id="CAP85368.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0008137"
FT                   /db_xref="GO:0019684"
FT                   /db_xref="GO:0048038"
FT                   /db_xref="GO:0051539"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006138"
FT                   /db_xref="InterPro:IPR014406"
FT                   /db_xref="UniParc:UPI00018319DE"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFD5"
FT                   /transl_table=1
FT                   /translation="MFPMAKPAISGALSAARPRFVASLPRAQPLAALSTSSIKSATALE
FT                   RQPSASAQQLTASGKARREVPLPSQEKKEGAMQYALTTLDQIANWARQSSLWPMTFGLA
FT                   CCAVEMMHLSTPRYDQDRLGIIFRASPRQSDVMIVAGTLTNKMAPALRQVYDQMPDPRW
FT                   VISMGSCANGGGYYHYSYSVVRGCDRVVPVDIYVPGCPPTSEALMYGIFQLQKKMRHTR
FT                   ITRMWYRR"
     MFPMAKPAIS GALSAARPRF VASLPRAQPL AALSTSSIKS ATALERQPSA SAQQLTASGK        60
     ARREVPLPSQ EKKEGAMQYA LTTLDQIANW ARQSSLWPMT FGLACCAVEM MHLSTPRYDQ       120
     DRLGIIFRAS PRQSDVMIVA GTLTNKMAPA LRQVYDQMPD PRWVISMGSC ANGGGYYHYS       180
     YSVVRGCDRV VPVDIYVPGC PPTSEALMYG IFQLQKKMRH TRITRMWYRR                  230
//

If you have problems or comments...

PBIL Back to PBIL home page