(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE390

PENCW_16.PE390       Location/Qualifiers
FT   CDS             join(complement(894704..894788),complement(894379..894624),
FT                   complement(893484..894323),complement(893240..893413),
FT                   complement(893075..893169))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000185710" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948897"
FT                   /orf_name="Pc20g03900"
FT                   /product="Pc20g03900 protein"
FT                   /function="tetracycline:hydrogen antiporter activity "
FT                   /biological_process="response to antibiotic"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP85719.1"
FT                   /db_xref="GO:0015520"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0046677"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI00018313B2"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH60"
FT                   /transl_table=1
FT                   /translation="MNDTKPWGYRWRSSRLLVVSSITVALFAETFLYGFLTPILSYMLE
FT                   ERLHLAPSQTQSYTTALLATHGFIGLVSAPIVAHLAERTPSQKKPLLIALAGCFIGTLM
FT                   IALAPSLWLLFLGRILQSMAGAATWVVGFALLANNVDKKHLGQSMGTAMSFVTAGIVGG
FT                   PTVSGALLQLFGYWAAWSLPLIVLVLDIIARLVMIEPGPGYSNIDALSKPAATSVPSNG
FT                   SPEESTALLSDTLSMVNPDESGVESKHNLKQEYYRAMLSEPRVLTALANVVVVSSLMSG
FT                   INNTLPVHLRQAFGWKSLLISTMFFCLQVPNIVLSGPSGWLRDRIGIRGPTVFGWLAMI
FT                   PLLLLLGMPGDAHFPWAGGHAAGKSIFTSSLIALGSILPLVRGVGAVQLAYVVKDMEAK
FT                   DPHIFEANKSNLRVFSMTEVGYSLGMMLGPLLTGSLFEGVGFFYMTVALGSDFLALAGY
FT                   LALTRSPRSLSLNIQAVDTYA"
     MNDTKPWGYR WRSSRLLVVS SITVALFAET FLYGFLTPIL SYMLEERLHL APSQTQSYTT        60
     ALLATHGFIG LVSAPIVAHL AERTPSQKKP LLIALAGCFI GTLMIALAPS LWLLFLGRIL       120
     QSMAGAATWV VGFALLANNV DKKHLGQSMG TAMSFVTAGI VGGPTVSGAL LQLFGYWAAW       180
     SLPLIVLVLD IIARLVMIEP GPGYSNIDAL SKPAATSVPS NGSPEESTAL LSDTLSMVNP       240
     DESGVESKHN LKQEYYRAML SEPRVLTALA NVVVVSSLMS GINNTLPVHL RQAFGWKSLL       300
     ISTMFFCLQV PNIVLSGPSG WLRDRIGIRG PTVFGWLAMI PLLLLLGMPG DAHFPWAGGH       360
     AAGKSIFTSS LIALGSILPL VRGVGAVQLA YVVKDMEAKD PHIFEANKSN LRVFSMTEVG       420
     YSLGMMLGPL LTGSLFEGVG FFYMTVALGS DFLALAGYLA LTRSPRSLSL NIQAVDTYA        479
//

If you have problems or comments...

PBIL Back to PBIL home page