(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE393

PENCW_16.PE393       Location/Qualifiers
FT   CDS             join(complement(899809..901304),complement(899476..899761))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000171253" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128994"
FT                   /orf_name="Pc20g03930"
FT                   /product="Pc20g03930 protein"
FT                   /function="serine-type endopeptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAP85722.1"
FT                   /db_xref="GO:0004252"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR009020"
FT                   /db_xref="InterPro:IPR015366"
FT                   /db_xref="UniParc:UPI00018313B5"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH63"
FT                   /transl_table=1
FT                   /translation="MRLQFLLLRALGLFLCYTQLVFAVDASYELVEQLDKAPDGWSRGD
FT                   KPPASKFIKFRLAIAQHNAREFEQKVIELSTPEHPSYGQHMSRDEVKQFLTPHPAISDR
FT                   IIAWLRSENVPANSINLYGHWVSFIVPIFQAERMLKTQFFYFHQQGQENPAIRTLGYSV
FT                   PRALRSHIQLIQPTTLFGNLVPQKSPVFKQKIATPEKLAAGCDVTITPDCLRDLYKIDN
FT                   TTTRPDWRNRLGISGFLEQYARHDDFNEFLRRYAQSHTDANFSVVSINGGQDGQHSMSD
FT                   SVEANLDVQYSIPLADEVLATFYSTGGRGPVVPEITHPDPTESSNEPYLEQLHYLLDLP
FT                   DEELPAVLSNSYGENEQSLPPSYLNATCSLFAQLGARGVSILFGSGDSGPGSSCVKNDG
FT                   TNQTRFLPGYPASCPFVTAVGGTYGTNPEKAVPFSGGGFSEVFSRPQYQDQAVKGYLGH
FT                   LGNQWNGLYNATGRGYPDISAQAANFIVRDQGDWISVGGTSASTPVLAGVISRLNAARI
FT                   AQGKPRMGFLNPWLYSHGQTGFTDIVLGSSSGCKWTSDARVRNASWDATEGWDPATGLG
FT                   TPLFPALVKLVLSDGQA"
     MRLQFLLLRA LGLFLCYTQL VFAVDASYEL VEQLDKAPDG WSRGDKPPAS KFIKFRLAIA        60
     QHNAREFEQK VIELSTPEHP SYGQHMSRDE VKQFLTPHPA ISDRIIAWLR SENVPANSIN       120
     LYGHWVSFIV PIFQAERMLK TQFFYFHQQG QENPAIRTLG YSVPRALRSH IQLIQPTTLF       180
     GNLVPQKSPV FKQKIATPEK LAAGCDVTIT PDCLRDLYKI DNTTTRPDWR NRLGISGFLE       240
     QYARHDDFNE FLRRYAQSHT DANFSVVSIN GGQDGQHSMS DSVEANLDVQ YSIPLADEVL       300
     ATFYSTGGRG PVVPEITHPD PTESSNEPYL EQLHYLLDLP DEELPAVLSN SYGENEQSLP       360
     PSYLNATCSL FAQLGARGVS ILFGSGDSGP GSSCVKNDGT NQTRFLPGYP ASCPFVTAVG       420
     GTYGTNPEKA VPFSGGGFSE VFSRPQYQDQ AVKGYLGHLG NQWNGLYNAT GRGYPDISAQ       480
     AANFIVRDQG DWISVGGTSA STPVLAGVIS RLNAARIAQG KPRMGFLNPW LYSHGQTGFT       540
     DIVLGSSSGC KWTSDARVRN ASWDATEGWD PATGLGTPLF PALVKLVLSD GQA              593
//

If you have problems or comments...

PBIL Back to PBIL home page