(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE394

PENCW_16.PE394       Location/Qualifiers
FT   CDS             join(902849..902966,903056..903216,903268..903981,
FT                   904044..904250)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195976" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948900"
FT                   /orf_name="Pc20g03940"
FT                   /product="Pc20g03940 protein"
FT                   /function="binding"
FT                   /protein_id="CAP85723.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR006599"
FT                   /db_xref="InterPro:IPR012945"
FT                   /db_xref="InterPro:IPR017901"
FT                   /db_xref="UniParc:UPI00018313B6"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH64"
FT                   /transl_table=1
FT                   /translation="MADAEIQQLRRPSADNQTVSKADIPLKERFFRYFQHEITDLQQEM
FT                   DRLADTSLVGGERADATDHCLAGIVRLSNEVKDAASYIPTYDQRVYAEAIKALQDRLSE
FT                   TRAAFEPRSKFSFKNKKNTSAVSLSDAAVLGVEGRLSIPGYHSPGGSSVDSSANNTPNY
FT                   PSTPLNEPDRQQQERPELAPTSFPGVSVGDFGGAKSPAGAFAATGISSVSVDDHQGLHI
FT                   MLPASGSTSTVPVSITSLDRCIVDMSIPTANGKPYASLTAKGVQESLLICGQVNGPAHI
FT                   TGVERSVIVVSCRQFRMHNCSNVDVYLSCSSNPIIEDCSNIRFGRIPKAYALNHDRPDH
FT                   EDRWSQVEDFKWIKPEPSPNWSLLDHNDAVPEEVWAEIVPGGPGWSLEDILHAIKVVPS
FT                   "
     MADAEIQQLR RPSADNQTVS KADIPLKERF FRYFQHEITD LQQEMDRLAD TSLVGGERAD        60
     ATDHCLAGIV RLSNEVKDAA SYIPTYDQRV YAEAIKALQD RLSETRAAFE PRSKFSFKNK       120
     KNTSAVSLSD AAVLGVEGRL SIPGYHSPGG SSVDSSANNT PNYPSTPLNE PDRQQQERPE       180
     LAPTSFPGVS VGDFGGAKSP AGAFAATGIS SVSVDDHQGL HIMLPASGST STVPVSITSL       240
     DRCIVDMSIP TANGKPYASL TAKGVQESLL ICGQVNGPAH ITGVERSVIV VSCRQFRMHN       300
     CSNVDVYLSC SSNPIIEDCS NIRFGRIPKA YALNHDRPDH EDRWSQVEDF KWIKPEPSPN       360
     WSLLDHNDAV PEEVWAEIVP GGPGWSLEDI LHAIKVVPS                              399
//

If you have problems or comments...

PBIL Back to PBIL home page