(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE395

PENCW_16.PE395       Location/Qualifiers
FT   CDS             join(complement(905825..906717),complement(905552..905766),
FT                   complement(905406..905497))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195954" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128995"
FT                   /orf_name="Pc20g03950"
FT                   /product="Pc20g03950 protein"
FT                   /protein_id="CAP85724.1"
FT                   /db_xref="UniParc:UPI00018313B7"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH65"
FT                   /transl_table=1
FT                   /translation="MVARTSSRNAAQKAKEAISTSPEPTGKTSKGTKRKASTEKAPQPK
FT                   KEKTEDTKPDEEKAEHVPDGPAAKREEEPVKAEEPSEAQPPKEKPVEAPSEKPQEVEGG
FT                   LRKSEERENVVSSNILEKGFIYFFFRPRVNIEEPQDIGDVSRSFFVLRPTVLGAEFDKG
FT                   QGPVDKDAKCRLMILPKKKYPTSPKERDMGFVEKAGQTMQELHEKFITGRTFETSTRGE
FT                   RHAEEARPYAEGVYAITSTPRASHLAYILTIPTELGDVQEDFGLQERGSWIVQSKSPKF
FT                   AGPPVGQLPKGPEYPPEVLEKFSDLRWVPLQPEFLDYPNSQFLMIGEAQNDLGKAAFAM
FT                   GGKQQHEEEPGQELEKLEDENENRVDSLKGDETVYEDLGYHAKNYPKVLTTWYTGESET
FT                   "
     MVARTSSRNA AQKAKEAIST SPEPTGKTSK GTKRKASTEK APQPKKEKTE DTKPDEEKAE        60
     HVPDGPAAKR EEEPVKAEEP SEAQPPKEKP VEAPSEKPQE VEGGLRKSEE RENVVSSNIL       120
     EKGFIYFFFR PRVNIEEPQD IGDVSRSFFV LRPTVLGAEF DKGQGPVDKD AKCRLMILPK       180
     KKYPTSPKER DMGFVEKAGQ TMQELHEKFI TGRTFETSTR GERHAEEARP YAEGVYAITS       240
     TPRASHLAYI LTIPTELGDV QEDFGLQERG SWIVQSKSPK FAGPPVGQLP KGPEYPPEVL       300
     EKFSDLRWVP LQPEFLDYPN SQFLMIGEAQ NDLGKAAFAM GGKQQHEEEP GQELEKLEDE       360
     NENRVDSLKG DETVYEDLGY HAKNYPKVLT TWYTGESET                              399
//

If you have problems or comments...

PBIL Back to PBIL home page