(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE396

PENCW_16.PE396       Location/Qualifiers
FT   CDS             complement(906921..907589)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128996"
FT                   /orf_name="Pc20g03960"
FT                   /product="Pc20g03960 protein"
FT                   /protein_id="CAP85725.1"
FT                   /db_xref="UniParc:UPI00018313B8"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH66"
FT                   /transl_table=1
FT                   /translation="MGNVPMDDTGPAKPDQPFEYFTGFTSSDAAADHQPEDTEQSMNGS
FT                   GPSTPTQDTDPFEESDNIRTIKPYDIEEPDDDLETSVPRVDILCLPDPFEQWQRELTDS
FT                   LNGLDYEHVGFDSNAMPLVRKRGKKRKPTHNALATQQCYPHLAQEHALAGTQPEEHGHS
FT                   PKRRKFSELQWHAQDIDSFGTFREANANESSGSETASIDLGGGIDGTNNSPMTDEMDID
FT                   "
     MGNVPMDDTG PAKPDQPFEY FTGFTSSDAA ADHQPEDTEQ SMNGSGPSTP TQDTDPFEES        60
     DNIRTIKPYD IEEPDDDLET SVPRVDILCL PDPFEQWQRE LTDSLNGLDY EHVGFDSNAM       120
     PLVRKRGKKR KPTHNALATQ QCYPHLAQEH ALAGTQPEEH GHSPKRRKFS ELQWHAQDID       180
     SFGTFREANA NESSGSETAS IDLGGGIDGT NNSPMTDEMD ID                          222
//

If you have problems or comments...

PBIL Back to PBIL home page