(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE397

PENCW_16.PE397       Location/Qualifiers
FT   CDS             join(908260..908271,908354..908403,908466..908785,
FT                   908845..910743,910795..911879,911944..912198)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195913" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948901"
FT                   /orf_name="Pc20g03970"
FT                   /product="Pc20g03970 protein"
FT                   /function="structural molecule activity"
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="COPI vesicle coat"
FT                   /protein_id="CAP85726.1"
FT                   /db_xref="GO:0005198"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="GO:0030126"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR006692"
FT                   /db_xref="InterPro:IPR010714"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR011048"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR016391"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI00018313B9"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH67"
FT                   /transl_table=1
FT                   /translation="MLTKFESKSSRAKGIAFHPKRPWILVSLHSSTIQLWDYRMGTLID
FT                   RFEEHDGPVRGVDFHPTQPLFVSGGDDYKIKVWNYQTRRCLFTLNGHLDYVRTVFFHPE
FT                   LPWILSASDDQTIRIWNWQNRSLICTMTGHNHYVMCAQFHPTEDLIASASLDQSVRIWD
FT                   ISGLRKKHSAPTSISFEDQMARANPNQADMFGNTDAVVKFVLEGHDRGVNWVSFHPTLP
FT                   LLVSAGDDRLVKLWRMSDTKAWEVDTCRGHFQNASAALFHPHQDLILSVGEDKTIRAWD
FT                   LNKRTSVQSFKRDLDRFWVIAAHPEMNLFAAGHDTGVMVFKLERERPASAIYQNQLFYI
FT                   TKDKHVKSYDFAKNVESPPMLSLRKLGSPWVPPRTLSYNPAERAILVTSPADNGTYELI
FT                   HLPRDATGAVEPTDVKRGQATSAVFVARNRFAVFNPSSQQVDIKDLSNSTTKTIKPPAG
FT                   TTDIYFGGTGCLLFITPTHVALFDIQQKKQLAELAVSGVKYVVWSNDGLYCALLSKHNV
FT                   TIVTKTLEQVSTLHETIRIKSATWDDAGVLLYSTLNHVKYSLLNGDNGIIRTLDQTVYL
FT                   VRVKGRSVYALDRNAQPRILEIDPTEYRFKLALVKRNYDEMLQIIKTSSLVGQSIISYL
FT                   QKKGYPEIALQFVQDPQTRFDLALECGNLEVANEMARELERPKIWSRLGAEALAHGNHQ
FT                   IVEMTYQKQRNFDKLSFLYLSTGDEEKLARMAKIAEHRGDFTSRFQNAIYRGDVEDRIQ
FT                   MFKEVDLYPLAYLTAKSHGLIEEAESILEAVGLTEDQIVLPTLEQPLKVPHPIVPTFQS
FT                   NWPVKAAGHSSFEKALLGEVGVDEEAGADGFDIEEEEQEAAVARETLDEDEEEVSGWDM
FT                   GDDVNVEEEVDFVNVESAEAGAGSSEADLWARNSPLAADHVAAGSFDTAMQLLNRQVGA
FT                   VQFAPLKARFLEVYKASKTYLPATAGLPPLVNYVRRTVDETELRKMLPIIPRDLETVAS
FT                   VDLQEGYAAMRSNKLEDGVATFKRILHTVLVNTVSSEAEVEEAKKIIATAREYILAMSI
FT                   ELERRSLTTDSPDNLKRSLELSAYFTIPKLEVAHRQLALMAAMKLAFANKNYGSALSFA
FT                   NRMLANGGSAKLLEQAKKIKAQCERNPQDQIDIDFDPFAEFDICAASYTPIYSGSPSVS
FT                   DPFTGAKYHPQYKGSVDRISDVTEIGAPASGLRLFVPSQF"
     MLTKFESKSS RAKGIAFHPK RPWILVSLHS STIQLWDYRM GTLIDRFEEH DGPVRGVDFH        60
     PTQPLFVSGG DDYKIKVWNY QTRRCLFTLN GHLDYVRTVF FHPELPWILS ASDDQTIRIW       120
     NWQNRSLICT MTGHNHYVMC AQFHPTEDLI ASASLDQSVR IWDISGLRKK HSAPTSISFE       180
     DQMARANPNQ ADMFGNTDAV VKFVLEGHDR GVNWVSFHPT LPLLVSAGDD RLVKLWRMSD       240
     TKAWEVDTCR GHFQNASAAL FHPHQDLILS VGEDKTIRAW DLNKRTSVQS FKRDLDRFWV       300
     IAAHPEMNLF AAGHDTGVMV FKLERERPAS AIYQNQLFYI TKDKHVKSYD FAKNVESPPM       360
     LSLRKLGSPW VPPRTLSYNP AERAILVTSP ADNGTYELIH LPRDATGAVE PTDVKRGQAT       420
     SAVFVARNRF AVFNPSSQQV DIKDLSNSTT KTIKPPAGTT DIYFGGTGCL LFITPTHVAL       480
     FDIQQKKQLA ELAVSGVKYV VWSNDGLYCA LLSKHNVTIV TKTLEQVSTL HETIRIKSAT       540
     WDDAGVLLYS TLNHVKYSLL NGDNGIIRTL DQTVYLVRVK GRSVYALDRN AQPRILEIDP       600
     TEYRFKLALV KRNYDEMLQI IKTSSLVGQS IISYLQKKGY PEIALQFVQD PQTRFDLALE       660
     CGNLEVANEM ARELERPKIW SRLGAEALAH GNHQIVEMTY QKQRNFDKLS FLYLSTGDEE       720
     KLARMAKIAE HRGDFTSRFQ NAIYRGDVED RIQMFKEVDL YPLAYLTAKS HGLIEEAESI       780
     LEAVGLTEDQ IVLPTLEQPL KVPHPIVPTF QSNWPVKAAG HSSFEKALLG EVGVDEEAGA       840
     DGFDIEEEEQ EAAVARETLD EDEEEVSGWD MGDDVNVEEE VDFVNVESAE AGAGSSEADL       900
     WARNSPLAAD HVAAGSFDTA MQLLNRQVGA VQFAPLKARF LEVYKASKTY LPATAGLPPL       960
     VNYVRRTVDE TELRKMLPII PRDLETVASV DLQEGYAAMR SNKLEDGVAT FKRILHTVLV      1020
     NTVSSEAEVE EAKKIIATAR EYILAMSIEL ERRSLTTDSP DNLKRSLELS AYFTIPKLEV      1080
     AHRQLALMAA MKLAFANKNY GSALSFANRM LANGGSAKLL EQAKKIKAQC ERNPQDQIDI      1140
     DFDPFAEFDI CAASYTPIYS GSPSVSDPFT GAKYHPQYKG SVDRISDVTE IGAPASGLRL      1200
     FVPSQF                                                                 1206
//

If you have problems or comments...

PBIL Back to PBIL home page