(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE398

PENCW_16.PE398       Location/Qualifiers
FT   CDS             join(complement(913249..913412),complement(912644..913166))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195924" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671933"
FT                   /orf_name="Pc20g03980"
FT                   /product="Pc20g03980 protein"
FT                   /function="thiol oxidase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP85727.1"
FT                   /db_xref="GO:0016972"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR006863"
FT                   /db_xref="InterPro:IPR017905"
FT                   /db_xref="UniParc:UPI00018313BA"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH68"
FT                   /transl_table=1
FT                   /translation="MSSVPPEQVNSQYKDMSSMFNQQNPAASASSSKPAGDDSKPPLPK
FT                   GVVLDKDGKPCRTCTSVASWRALTKQADLKSANSNSTSTPTSSTSKMTTPTAGLAAAAT
FT                   PSPSETPSDCPPDVEELGRSTWTLLHSMAATYPEKADAEHQANMSGFLKFFSKLYPCWV
FT                   CADDFRAWMAHPSGRNQPKLGSRKEFGWWMCEAHNEVNRKLGKKEFDCRLWEERWRTGW
FT                   KDGRCD"
     MSSVPPEQVN SQYKDMSSMF NQQNPAASAS SSKPAGDDSK PPLPKGVVLD KDGKPCRTCT        60
     SVASWRALTK QADLKSANSN STSTPTSSTS KMTTPTAGLA AAATPSPSET PSDCPPDVEE       120
     LGRSTWTLLH SMAATYPEKA DAEHQANMSG FLKFFSKLYP CWVCADDFRA WMAHPSGRNQ       180
     PKLGSRKEFG WWMCEAHNEV NRKLGKKEFD CRLWEERWRT GWKDGRCD                    228
//

If you have problems or comments...

PBIL Back to PBIL home page