(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE399

PENCW_16.PE399       Location/Qualifiers
FT   CDS             join(913917..914180,914387..915223)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195925" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948902"
FT                   /orf_name="Pc20g03990"
FT                   /product="Pc20g03990 protein"
FT                   /protein_id="CAP85728.1"
FT                   /db_xref="UniParc:UPI00018313BB"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH69"
FT                   /transl_table=1
FT                   /translation="MPPKYTMFTMSDSESEAEREVSNIPSDQVLEKTLRDQVATIFKSG
FT                   NMEELTVKRVRLAAEDTLGLTAGYFKSTGDWKARSENIIKDEVRQKTRTPVSDEEEELS
FT                   VPPSDESDRVTKPKKRSKAPVNKSPVKASVQKPKKDTSDASDFSGDESEEVTMPKKRSK
FT                   APVKKSPTKKPSVHKPMKDISDASDVPHDTSDVAKETRDTKDDSESEMSVVLDEEPQPK
FT                   APRKRQKSAGGTATKTKKKAPKAKDEDISPDQAEIRRLQGWLVKCGIRKLWGKELAPYD
FT                   TPKAKIKHLKKMLEDAGMTGRPSQEKANQIREERELKADLEQIQEGAKQWGAKSDEEDE
FT                   DAKPRRRLARGRQSLAFLESDGEETD"
     MPPKYTMFTM SDSESEAERE VSNIPSDQVL EKTLRDQVAT IFKSGNMEEL TVKRVRLAAE        60
     DTLGLTAGYF KSTGDWKARS ENIIKDEVRQ KTRTPVSDEE EELSVPPSDE SDRVTKPKKR       120
     SKAPVNKSPV KASVQKPKKD TSDASDFSGD ESEEVTMPKK RSKAPVKKSP TKKPSVHKPM       180
     KDISDASDVP HDTSDVAKET RDTKDDSESE MSVVLDEEPQ PKAPRKRQKS AGGTATKTKK       240
     KAPKAKDEDI SPDQAEIRRL QGWLVKCGIR KLWGKELAPY DTPKAKIKHL KKMLEDAGMT       300
     GRPSQEKANQ IREERELKAD LEQIQEGAKQ WGAKSDEEDE DAKPRRRLAR GRQSLAFLES       360
     DGEETD                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page