(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE400

PENCW_16.PE400       Location/Qualifiers
FT   CDS             join(915969..916045,916120..916140,916217..916348,
FT                   916411..917048,917101..917669,917722..918083,9
FT                   18136..918565)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000163270" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948903"
FT                   /orf_name="Pc20g04000"
FT                   /product="Pc20g04000 protein"
FT                   /function="binding"
FT                   /function="protein transporter activity"
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="membrane coat"
FT                   /protein_id="CAP85729.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="GO:0030117"
FT                   /db_xref="InterPro:IPR002553"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR016342"
FT                   /db_xref="UniParc:UPI00018313BC"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH70"
FT                   /transl_table=1
FT                   /translation="MAMNKIRGAFTVPRKGETFELRAGLVSQYAYERKESIQKTIMAMT
FT                   LGKDVSALFPDVLKNIATGDLEQKKLVYLYLMNYAKSHPDLCILAVNTFVQDSEDPNPL
FT                   IRALAIRTMGCIRVDKMVDYMEEPLRKTLRDESPYVRKTAAICVAKLFDLNPAMALENG
FT                   FLEMLQEMIGDPNPMVVANSVTALQEIHHTAPETQALQITSNTLRKMLMALNECTEWGR
FT                   VTILTTLAEYKTSDVKESEHICERVAPQFQHVNSGVVLAAVKAVFLHMKNVNPDLSKNY
FT                   LKKMAPPLVTLVSSAPEVQYVALRNIDLLLQKEPDILNKELRVFFCKYNDPPYVKFQKL
FT                   EIMVRIANDRNVDQLLAELKEYALEVDMDFVRRAVRAIGQVAIKIESASERCVNTLLDL
FT                   INTKVNYVVQEAIVVIKDIFRKYPGYEGIIPTLCQCIDELDEPNARAALIWIVGEYAEK
FT                   ISNAGDILGGFVDGFNEEFSSTQLQILTAVVKLFLKRPEKAQGLVQRVLQAATSENDNP
FT                   DVRDRAYIYWRLLSNTSDSNATKNIVLSDKPPIVTTIHSLPPSLLDQLLSELSTLSSVY
FT                   HKPPEQFVGHGRFGADAVMRAAIEEQLQNARENPLAAAAAAAAGGTTAPAQAQNNVENL
FT                   LDIDFDGGAPASAQTEPSSGMSGLEGLAGTPVRVASPAAGTTTGQASNNLDDLLGVFGD
FT                   SGAAQPSSSGANSGDLMNGFSGLDLSGNAGPSQNTQTKKSNDDILSLF"
     MAMNKIRGAF TVPRKGETFE LRAGLVSQYA YERKESIQKT IMAMTLGKDV SALFPDVLKN        60
     IATGDLEQKK LVYLYLMNYA KSHPDLCILA VNTFVQDSED PNPLIRALAI RTMGCIRVDK       120
     MVDYMEEPLR KTLRDESPYV RKTAAICVAK LFDLNPAMAL ENGFLEMLQE MIGDPNPMVV       180
     ANSVTALQEI HHTAPETQAL QITSNTLRKM LMALNECTEW GRVTILTTLA EYKTSDVKES       240
     EHICERVAPQ FQHVNSGVVL AAVKAVFLHM KNVNPDLSKN YLKKMAPPLV TLVSSAPEVQ       300
     YVALRNIDLL LQKEPDILNK ELRVFFCKYN DPPYVKFQKL EIMVRIANDR NVDQLLAELK       360
     EYALEVDMDF VRRAVRAIGQ VAIKIESASE RCVNTLLDLI NTKVNYVVQE AIVVIKDIFR       420
     KYPGYEGIIP TLCQCIDELD EPNARAALIW IVGEYAEKIS NAGDILGGFV DGFNEEFSST       480
     QLQILTAVVK LFLKRPEKAQ GLVQRVLQAA TSENDNPDVR DRAYIYWRLL SNTSDSNATK       540
     NIVLSDKPPI VTTIHSLPPS LLDQLLSELS TLSSVYHKPP EQFVGHGRFG ADAVMRAAIE       600
     EQLQNARENP LAAAAAAAAG GTTAPAQAQN NVENLLDIDF DGGAPASAQT EPSSGMSGLE       660
     GLAGTPVRVA SPAAGTTTGQ ASNNLDDLLG VFGDSGAAQP SSSGANSGDL MNGFSGLDLS       720
     GNAGPSQNTQ TKKSNDDILS LF                                                742
//

If you have problems or comments...

PBIL Back to PBIL home page