(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE401

PENCW_16.PE401       Location/Qualifiers
FT   CDS             join(919345..919521,919620..920522)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000294667" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948904"
FT                   /orf_name="Pc20g04010"
FT                   /product="Pc20g04010 protein"
FT                   /function="oxidoreductase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP85730.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI00018313BD"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD86"
FT                   /transl_table=1
FT                   /translation="MAQTDYKFEGWMGLDPSAAEGKMVWQEFQPKEWEETDVDIKVTHC
FT                   GICGSDIHTLRSGWRPTAYPCCVGHEIVGTAVRVGSKVSGGIQIGDRVGVGAQSESCLG
FT                   RLGDCEECASGQENYCSKKVVGTYNSIHYDGSKSYGGYARYHRVPGHFAIKIPSAIPSA
FT                   DAAPMLCGGATLYSPLKHNGCGPGKRVGIIGVGGLGHFGLLFAKAMGADKVVAISRKMG
FT                   KKEDSLKMGADLYIATDDEPDWATVNARSLDLIVSTVSSTKMPFNDYLGLLKTGGSFVQ
FT                   VGLPEDGGLFAPVRSLMRRLKLQSSLVGSPNEIREMFQLVSEKGIRPWVQEIPMKDANK
FT                   AIVDMEDGKARYRYVLVNE"
     MAQTDYKFEG WMGLDPSAAE GKMVWQEFQP KEWEETDVDI KVTHCGICGS DIHTLRSGWR        60
     PTAYPCCVGH EIVGTAVRVG SKVSGGIQIG DRVGVGAQSE SCLGRLGDCE ECASGQENYC       120
     SKKVVGTYNS IHYDGSKSYG GYARYHRVPG HFAIKIPSAI PSADAAPMLC GGATLYSPLK       180
     HNGCGPGKRV GIIGVGGLGH FGLLFAKAMG ADKVVAISRK MGKKEDSLKM GADLYIATDD       240
     EPDWATVNAR SLDLIVSTVS STKMPFNDYL GLLKTGGSFV QVGLPEDGGL FAPVRSLMRR       300
     LKLQSSLVGS PNEIREMFQL VSEKGIRPWV QEIPMKDANK AIVDMEDGKA RYRYVLVNE        359
//

If you have problems or comments...

PBIL Back to PBIL home page