(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE402

PENCW_16.PE402       Location/Qualifiers
FT   CDS             join(920780..920833,920898..922457)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000230745" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671934"
FT                   /orf_name="Pc20g04020"
FT                   /product="Pc20g04020 protein"
FT                   /EC_number="4.2.3.1"
FT                   /function="pyridoxal phosphate binding"
FT                   /function="threonine synthase activity"
FT                   /biological_process="threonine biosynthetic process "
FT                   /protein_id="CAP85731.1"
FT                   /db_xref="GO:0004795"
FT                   /db_xref="GO:0009088"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="UniParc:UPI00018313BE"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD87"
FT                   /transl_table=1
FT                   /translation="MSPTLSQQYLSTRGAEYGRTFEDVVLQGLASDGGLFIPEEMPTLP
FT                   KSWETEWRDLSFEDLALEIMSLYISTDEIPREDLKNIIYKSYSTFRHPERTPSVLLEKN
FT                   LYLLELFHGPTFAFKDVALSFLGNLFEYFLVRKNAGKTGKDRHHLTVVGATSGDTGSAA
FT                   IYGLRGKKDVSVFILFPDGGRVSPIQEKQMTTILDPNVHNLTVAGSFDHCQDIVKSLFA
FT                   DEDLNSTHNIAAVNSINMARILAQITYFIYSYFALTKTPSFNKDSKVRVVVPSGNFGDI
FT                   LAGWFAKSMGLPIEKLVIATNANDILDRFFRSGGHYTKKALDAPTDHGVKETHSPAMDI
FT                   LVSSNFERLLWFLSYQTTSGTEADRRKHACESVSGWLNELKTNGGFQVPSEVLEAAKVD
FT                   FESERVSNEETIAMIRDIYKTSFPKGLGPGSAKSSKTGGYILDPHTAVGVAATRRSMAR
FT                   NPDATHISLSTAHPAKFAGAVDLALRGEDGYDFTEILPQEFIGLEQRESRVTPVGESAG
FT                   WQGVKEIVKAELEQELQGLR"
     MSPTLSQQYL STRGAEYGRT FEDVVLQGLA SDGGLFIPEE MPTLPKSWET EWRDLSFEDL        60
     ALEIMSLYIS TDEIPREDLK NIIYKSYSTF RHPERTPSVL LEKNLYLLEL FHGPTFAFKD       120
     VALSFLGNLF EYFLVRKNAG KTGKDRHHLT VVGATSGDTG SAAIYGLRGK KDVSVFILFP       180
     DGGRVSPIQE KQMTTILDPN VHNLTVAGSF DHCQDIVKSL FADEDLNSTH NIAAVNSINM       240
     ARILAQITYF IYSYFALTKT PSFNKDSKVR VVVPSGNFGD ILAGWFAKSM GLPIEKLVIA       300
     TNANDILDRF FRSGGHYTKK ALDAPTDHGV KETHSPAMDI LVSSNFERLL WFLSYQTTSG       360
     TEADRRKHAC ESVSGWLNEL KTNGGFQVPS EVLEAAKVDF ESERVSNEET IAMIRDIYKT       420
     SFPKGLGPGS AKSSKTGGYI LDPHTAVGVA ATRRSMARNP DATHISLSTA HPAKFAGAVD       480
     LALRGEDGYD FTEILPQEFI GLEQRESRVT PVGESAGWQG VKEIVKAELE QELQGLR          537
//

If you have problems or comments...

PBIL Back to PBIL home page