(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE403

PENCW_16.PE403       Location/Qualifiers
FT   CDS             join(complement(924407..924678),complement(924086..924331),
FT                   complement(923956..924025),complement(922839..923894))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000200122" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948905"
FT                   /orf_name="Pc20g04030"
FT                   /product="Pc20g04030 protein"
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP85732.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001831497"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD88"
FT                   /transl_table=1
FT                   /translation="MAGGAAINVFKFNTGGLPKETLNFKLWFAVFAFGLMGAARGVDEG
FT                   LITGVFNSHAFKRSVGIDDLDKDDLASVKGTISSMVQLGSVAGALLAFIVCDRIGRVWA
FT                   TRQLCVLWILGIAIFIGNNGNMAAVYAGRFIAGLGIGQTCVVGPIYLSEISPAPIRGLC
FT                   TCMFTGAVYLGIMIAYFANWGTQIHMADTFNRWAVPTSLHLMFAGIILLLTFFQLESPR
FT                   FYIKQGKREKALEVLCKLRGLPAHHPYVLNEISEMDVAYQEEMEATLGMGWKGLFKEIL
FT                   GIKRNAYRLFLTNLAQNMACWSGGSAITVYAPDLFTLVGITGQEQSLFSTVVFGVVKFV
FT                   AAIICALFLVDMAGRKRSLIIGIVIQTVAMFYIAIFLNLVPIAENPDFVPSETQNRAST
FT                   AAIAFIYISGVGWALGWNSGQYLLSSELFPLRIRGICSSITMAMHFICQYAVNRVLPEM
FT                   LLEDTGLGPHGTFYFFGVISIVGGIWVWLFVPEAAGRSLETIDKMFDLPWYKIGLYGRK
FT                   FAEEYDREQEAIYRDEKRDAGIVVSHNETA"
     MAGGAAINVF KFNTGGLPKE TLNFKLWFAV FAFGLMGAAR GVDEGLITGV FNSHAFKRSV        60
     GIDDLDKDDL ASVKGTISSM VQLGSVAGAL LAFIVCDRIG RVWATRQLCV LWILGIAIFI       120
     GNNGNMAAVY AGRFIAGLGI GQTCVVGPIY LSEISPAPIR GLCTCMFTGA VYLGIMIAYF       180
     ANWGTQIHMA DTFNRWAVPT SLHLMFAGII LLLTFFQLES PRFYIKQGKR EKALEVLCKL       240
     RGLPAHHPYV LNEISEMDVA YQEEMEATLG MGWKGLFKEI LGIKRNAYRL FLTNLAQNMA       300
     CWSGGSAITV YAPDLFTLVG ITGQEQSLFS TVVFGVVKFV AAIICALFLV DMAGRKRSLI       360
     IGIVIQTVAM FYIAIFLNLV PIAENPDFVP SETQNRASTA AIAFIYISGV GWALGWNSGQ       420
     YLLSSELFPL RIRGICSSIT MAMHFICQYA VNRVLPEMLL EDTGLGPHGT FYFFGVISIV       480
     GGIWVWLFVP EAAGRSLETI DKMFDLPWYK IGLYGRKFAE EYDREQEAIY RDEKRDAGIV       540
     VSHNETA                                                                 547
//

If you have problems or comments...

PBIL Back to PBIL home page