(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE404

PENCW_16.PE404       Location/Qualifiers
FT   CDS             complement(926969..927454)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977863"
FT                   /orf_name="Pc20g04040"
FT                   /product="Putative uncharacterized protein Pc20g04040 "
FT                   /protein_id="CAP85733.1"
FT                   /db_xref="UniParc:UPI0001831498"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD89"
FT                   /transl_table=1
FT                   /translation="MADDVFEIKLFCASRFAPPSMTKMIDRGSIWTRAVSTVELLTETF
FT                   QLSPQFHPCSANIDLLSFTTIIYGDELRHKRGDSSNTQFSRCIVGSLINIVKYLFPSFV
FT                   GPRDVPDSSTLEWASMLRLRQESLTELAEELYNHLRGGGEQSLRLAPNTIMELEDIE"
     MADDVFEIKL FCASRFAPPS MTKMIDRGSI WTRAVSTVEL LTETFQLSPQ FHPCSANIDL        60
     LSFTTIIYGD ELRHKRGDSS NTQFSRCIVG SLINIVKYLF PSFVGPRDVP DSSTLEWASM       120
     LRLRQESLTE LAEELYNHLR GGGEQSLRLA PNTIMELEDI E                           161
//

If you have problems or comments...

PBIL Back to PBIL home page