(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE405

PENCW_16.PE405       Location/Qualifiers
FT   CDS             join(complement(928782..928794),complement(928631..928731),
FT                   complement(928437..928571),complement(928245..928379))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000171591" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948906"
FT                   /orf_name="Pc20g04050"
FT                   /product="Pc20g04050 protein"
FT                   /function="actin binding"
FT                   /biological_process="actin cytoskeleton organization "
FT                   /cellular_component="actin cytoskeleton"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAP85734.1"
FT                   /db_xref="GO:0003779"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0015629"
FT                   /db_xref="GO:0030036"
FT                   /db_xref="InterPro:IPR002097"
FT                   /db_xref="InterPro:IPR005455"
FT                   /db_xref="UniParc:UPI0001831499"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD90"
FT                   /transl_table=1
FT                   /translation="MSWQGWVDQTLVGSKKVDKAAIFSAGGDALLATSAGFNVQLEEVQ
FT                   YMLRGFEDSIPLYSGGLYVAGERLMVTKADDQSIYAEKGKEGVCVVRSSQSIIVAHYPE
FT                   TVQSREAASIVGQLANYLTSIGY"
     MSWQGWVDQT LVGSKKVDKA AIFSAGGDAL LATSAGFNVQ LEEVQYMLRG FEDSIPLYSG        60
     GLYVAGERLM VTKADDQSIY AEKGKEGVCV VRSSQSIIVA HYPETVQSRE AASIVGQLAN       120
     YLTSIGY                                                                 127
//

If you have problems or comments...

PBIL Back to PBIL home page