(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE406

PENCW_16.PE406       Location/Qualifiers
FT   CDS             join(complement(930605..931091),complement(929509..930542))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128997"
FT                   /orf_name="Pc20g04060"
FT                   /product="Pc20g04060 protein"
FT                   /protein_id="CAP85735.1"
FT                   /db_xref="UniParc:UPI000183149A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD91"
FT                   /transl_table=1
FT                   /translation="MVNSVAILALASPAFAGIMQARGEQFVRPAAQSSAAVAAPAHAEG
FT                   WGESWSKPAEHVSTHDSWSKSTESWTTPCTTSTTTPVHHHTTTTPVHSDTTTPVHSNTT
FT                   TPCTTSTTPVHTTTPVQSNSTTPCTTSTTPVHEHTTKPHVPVKPGTTKTLTYVTTTCPV
FT                   TSSTVTSGSKTWTVPVTGTSTITITKTTVCTMCENEKPVTFHNATQPAPHPTAGPTAPV
FT                   LKPTGDVVIPEKPHHSKPVEPKPVETKPVEPKPVETKPVEPKPVETKPAVPAHSEPAVP
FT                   AHSQPAVPAHSEPAVPAHSEPAVPAHSQPAVPAHSEPAVPAHSQPAVPAHSEPAVPAHS
FT                   EPAVPAHSQPAVPAHSEPAVPAHSQPAVPAHSEPAVPAHSEPAVPAHSQPAVPAHSQPA
FT                   VPAHSQPAVPAHSQPAVPAHSQPAASQPAASKPAASQPAASKPAQSKPAAPKETQPAAN
FT                   PSVPETPETPSKPEEPVSPSSNEFTGAASNVKPVAGLLAGVVGLMALL"
     MVNSVAILAL ASPAFAGIMQ ARGEQFVRPA AQSSAAVAAP AHAEGWGESW SKPAEHVSTH        60
     DSWSKSTESW TTPCTTSTTT PVHHHTTTTP VHSDTTTPVH SNTTTPCTTS TTPVHTTTPV       120
     QSNSTTPCTT STTPVHEHTT KPHVPVKPGT TKTLTYVTTT CPVTSSTVTS GSKTWTVPVT       180
     GTSTITITKT TVCTMCENEK PVTFHNATQP APHPTAGPTA PVLKPTGDVV IPEKPHHSKP       240
     VEPKPVETKP VEPKPVETKP VEPKPVETKP AVPAHSEPAV PAHSQPAVPA HSEPAVPAHS       300
     EPAVPAHSQP AVPAHSEPAV PAHSQPAVPA HSEPAVPAHS EPAVPAHSQP AVPAHSEPAV       360
     PAHSQPAVPA HSEPAVPAHS EPAVPAHSQP AVPAHSQPAV PAHSQPAVPA HSQPAVPAHS       420
     QPAASQPAAS KPAASQPAAS KPAQSKPAAP KETQPAANPS VPETPETPSK PEEPVSPSSN       480
     EFTGAASNVK PVAGLLAGVV GLMALL                                            506
//

If you have problems or comments...

PBIL Back to PBIL home page