(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE409

PENCW_16.PE409       Location/Qualifiers
FT   CDS             join(complement(936712..936880),complement(936576..936660),
FT                   complement(936242..936524))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196054" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948909"
FT                   /orf_name="Pc20g04090"
FT                   /product="Pc20g04090 protein"
FT                   /protein_id="CAP85738.1"
FT                   /db_xref="InterPro:IPR021346"
FT                   /db_xref="UniParc:UPI000183149D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD94"
FT                   /transl_table=1
FT                   /translation="MPVTLEKVHKQISKKRSSTNALHENSRDAHRLRKAGARDDRLSRH
FT                   NATVNRARQPYLDRIDYIHEAIQECTEALSTEEISEFVAKYIARDAEEIKQLESERRKG
FT                   RPPSKREEALKQRVQTEDREFATGLWMPDLSDQYAMTAMKNWNGHWSGLSAIKFMRFTK
FT                   DGEKLTSTFPPKSMS"
     MPVTLEKVHK QISKKRSSTN ALHENSRDAH RLRKAGARDD RLSRHNATVN RARQPYLDRI        60
     DYIHEAIQEC TEALSTEEIS EFVAKYIARD AEEIKQLESE RRKGRPPSKR EEALKQRVQT       120
     EDREFATGLW MPDLSDQYAM TAMKNWNGHW SGLSAIKFMR FTKDGEKLTS TFPPKSMS         178
//

If you have problems or comments...

PBIL Back to PBIL home page