(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE41

PENCW_16.PE41        Location/Qualifiers
FT   CDS             join(complement(93257..93404),complement(92130..93196))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000036504" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946686"
FT                   /orf_name="Pc20g00410"
FT                   /product="Pc20g00410 protein"
FT                   /function="transferase activity"
FT                   /protein_id="CAP85370.1"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniParc:UPI00018319E0"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFD7"
FT                   /transl_table=1
FT                   /translation="MLSRLHPRGHLRQRSIVHVTLQVLATRSRPTNPNLLPSRRDLHTA
FT                   LFFPGHGVQRVGMANSWIESFPNTAAKVLDEMDSTLGFKLSSIISDGPNSKLNKTENSQ
FT                   PAVMAISVLILRILEQEFGFNTKSRVDVTLGHSLGEFSALVAGGYLEFGDALKLVRGRA
FT                   EMMARCTRQLSEQSGESYGMVALLCEPEHLEGLLRTVQDFVGPESPGIEIDRDNRVPLI
FT                   QQVVVANINSKNQIVLSGSLDRIKILLVQMRQFGGHDPRAVRLKSDSPFHSPAMALAAD
FT                   YMRDAVENISITFPASIPCISNVSALPFQSKEDIRDLLSRQCIETVRWWDSIRYLHQER
FT                   GVRRWIGIGPGKVGRNLVGKEVGRVNTKGGGVWAVCDPREMSEIMVALEQTEAETGDTQ
FT                   PELAG"
     MLSRLHPRGH LRQRSIVHVT LQVLATRSRP TNPNLLPSRR DLHTALFFPG HGVQRVGMAN        60
     SWIESFPNTA AKVLDEMDST LGFKLSSIIS DGPNSKLNKT ENSQPAVMAI SVLILRILEQ       120
     EFGFNTKSRV DVTLGHSLGE FSALVAGGYL EFGDALKLVR GRAEMMARCT RQLSEQSGES       180
     YGMVALLCEP EHLEGLLRTV QDFVGPESPG IEIDRDNRVP LIQQVVVANI NSKNQIVLSG       240
     SLDRIKILLV QMRQFGGHDP RAVRLKSDSP FHSPAMALAA DYMRDAVENI SITFPASIPC       300
     ISNVSALPFQ SKEDIRDLLS RQCIETVRWW DSIRYLHQER GVRRWIGIGP GKVGRNLVGK       360
     EVGRVNTKGG GVWAVCDPRE MSEIMVALEQ TEAETGDTQP ELAG                        404
//

If you have problems or comments...

PBIL Back to PBIL home page