(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE411

PENCW_16.PE411       Location/Qualifiers
FT   CDS             join(complement(940279..940478),complement(939931..940128),
FT                   complement(939783..939843))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824646"
FT                   /orf_name="Pc20g04110"
FT                   /product="Putative uncharacterized protein Pc20g04110 "
FT                   /protein_id="CAP85740.1"
FT                   /db_xref="UniParc:UPI000183149F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD96"
FT                   /transl_table=1
FT                   /translation="MTTSGSNSCTFLLTRFSVSEKELPELNAITQLNWTPVAHLLLVRV
FT                   IGTTGESKSRSLEWNVDEECGCTGGKYMKDRECVEGMEQKEGISAGTKLNVKLIDRFSE
FT                   SLWRLGMRQEYTKSRRLGQPLLFTVPLPRADLDNLRPTAISHAIHPAS"
     MTTSGSNSCT FLLTRFSVSE KELPELNAIT QLNWTPVAHL LLVRVIGTTG ESKSRSLEWN        60
     VDEECGCTGG KYMKDRECVE GMEQKEGISA GTKLNVKLID RFSESLWRLG MRQEYTKSRR       120
     LGQPLLFTVP LPRADLDNLR PTAISHAIHP AS                                     152
//

If you have problems or comments...

PBIL Back to PBIL home page